BAFF/TNFSF13B Protein, Mouse (HEK293)

BAFF/TNFSF13B protein binds to TNFRSF13B and TNFRSF17, stimulates B-cell and T-cell function and regulates humoral immunity. BAFF/TNFSF13B also interacts with TNFSF13 to promote the survival and response of mature B cells. BAFF/TNFSF13B Protein, Mouse (HEK293) is the recombinant mouse-derived BAFF/TNFSF13B protein, expressed by HEK293, with tag free.

BAFF/TNFSF13B Protein is a cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA, forming a 2 ligands-2 receptors pathway that plays a crucial role in the stimulation of B- and T-cell function, as well as the regulation of humoral immunity. Additionally, BAFF/TNFSF13B interacts with TNFSF13/APRIL, which also binds to the same two receptors. The BAFF/TNFSF13B-BAFFR/BR3 interaction specifically promotes the survival of mature B-cells and enhances the overall B-cell response. Notably, isoform 2 of BAFF/TNFSF13B appears to inhibit the secretion and bioactivity of isoform 1.

Measured by its binding ability in a functional ELISA. Immobilized Mouse BAFF, Tag Free at 2 μg/mL (100 μL/well) can bind Mouse BAFFR, Fc Tag. with the EC₅₀ of 2.65 ng/mL.

Mouse

HEK293

Tag Free

Q9WU72 (A127-L309)

24099

Full Length of TNFSF13B soluble form

AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with 10% trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.