1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. B-cell Activating Factor (BAFF)
  6. BAFF/TNFSF13B Protein, Mouse (HEK293)

BAFF/TNFSF13B protein binds to TNFRSF13B and TNFRSF17, stimulates B-cell and T-cell function and regulates humoral immunity. BAFF/TNFSF13B also interacts with TNFSF13 to promote the survival and response of mature B cells. BAFF/TNFSF13B Protein, Mouse (HEK293) is the recombinant mouse-derived BAFF/TNFSF13B protein, expressed by HEK293, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BAFF/TNFSF13B protein binds to TNFRSF13B and TNFRSF17, stimulates B-cell and T-cell function and regulates humoral immunity. BAFF/TNFSF13B also interacts with TNFSF13 to promote the survival and response of mature B cells. BAFF/TNFSF13B Protein, Mouse (HEK293) is the recombinant mouse-derived BAFF/TNFSF13B protein, expressed by HEK293, with tag free.

Background

BAFF/TNFSF13B Protein is a cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA, forming a 2 ligands-2 receptors pathway that plays a crucial role in the stimulation of B- and T-cell function, as well as the regulation of humoral immunity. Additionally, BAFF/TNFSF13B interacts with TNFSF13/APRIL, which also binds to the same two receptors. The BAFF/TNFSF13B-BAFFR/BR3 interaction specifically promotes the survival of mature B-cells and enhances the overall B-cell response. Notably, isoform 2 of BAFF/TNFSF13B appears to inhibit the secretion and bioactivity of isoform 1.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse BAFF, Tag Free at 2 μg/mL (100 μL/well) can bind Mouse BAFFR, Fc Tag. with the EC50 of 2.65 ng/mL.

Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

Q9WU72 (A127-L309)

Gene ID

24099

Molecular Construction
N-term
BAFF (A127-L309)
Accession # Q9WU72
C-term
Protein Length

Full Length of TNFSF13B soluble form

Synonyms
Tumor necrosis factor ligand superfamily member 13B; B lymphocyte stimulator; BLyS; B-cell-activating factor; BAFF; Dendritic cell-derived TNF-like molecule; TNF- and APOL-related leukocyte expressed ligand 1; TALL-1
AA Sequence

AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL

Predicted Molecular Mass
20.9 kDa
Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with 10% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BAFF/TNFSF13B Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BAFF/TNFSF13B Protein, Mouse (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BAFF/TNFSF13B Protein, Mouse (HEK293)
Cat. No.:
HY-P704315
Quantity:
MCE Japan Authorized Agent: