Copy Link Print Information

BAFF/TNFSF13B Protein, Mouse (HEK293)

Customer Review

Based on 1 Customer Validation

BAFF/TNFSF13B protein binds to TNFRSF13B and TNFRSF17, stimulates B-cell and T-cell function and regulates humoral immunity. BAFF/TNFSF13B also interacts with TNFSF13 to promote the survival and response of mature B cells. BAFF/TNFSF13B Protein, Mouse (HEK293) is the recombinant mouse-derived BAFF/TNFSF13B protein, expressed by HEK293, with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • BAFF/TNFSF13B Protein, Mouse (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

BAFF/TNFSF13B protein binds to TNFRSF13B and TNFRSF17, stimulates B-cell and T-cell function and regulates humoral immunity. BAFF/TNFSF13B also interacts with TNFSF13 to promote the survival and response of mature B cells. BAFF/TNFSF13B Protein, Mouse (HEK293) is the recombinant mouse-derived BAFF/TNFSF13B protein, expressed by HEK293, with tag free.

Background

BAFF/TNFSF13B Protein is a cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA, forming a 2 ligands-2 receptors pathway that plays a crucial role in the stimulation of B- and T-cell function, as well as the regulation of humoral immunity. Additionally, BAFF/TNFSF13B interacts with TNFSF13/APRIL, which also binds to the same two receptors. The BAFF/TNFSF13B-BAFFR/BR3 interaction specifically promotes the survival of mature B-cells and enhances the overall B-cell response. Notably, isoform 2 of BAFF/TNFSF13B appears to inhibit the secretion and bioactivity of isoform 1.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse BAFF, Tag Free at 2 μg/mL (100 μL/well) can bind Mouse BAFFR, Fc Tag. with the EC50 of 2.65 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession

    Q9WU72 (A127-L309)

  • Gene ID
    24099
  • Molecular Construction
    • N-term
    • BAFF (A127-L309)
      Accession # Q9WU72
    • C-term
  • Protein Length

    Full Length of TNFSF13B, soluble form

  • Synonyms

    TNFSF13B; Dendritic Cell-Derived TNF-Like Molecule; Prev. TNFSF20; Tumor Necrosis Factor Ligand 7A; TALL-1; ZTNF4; TALL1; Tumor Necrosis Factor (Ligand) Superfamily, Member 20; BAFF; TNF- And APOL-Related Leukocyte Expressed Ligand 1; BLYS; Tumor Necrosis

  • AA Sequence

    AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL

  • Predicted Molecular Mass

    20.9 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with 10% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • BAFF/TNFSF13B Protein, Mouse (HEK293) Product Image
    1/16
  • BAFF/TNFSF13B Protein, Mouse (HEK293) Product Image