BCAS2 Protein, Human (N-GST)
Based on 1 Customer Validation
BCAS2 is essential for pre-mRNA splicing and is critical for spliceosome activation as a key component of the activated spliceosome and the PRP19-CDC5L complex. It may act as a scaffold in spliceosome assembly, forming contacts with core components. BCAS2 Protein, Human (N-GST) is the recombinant human-derived BCAS2 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
BCAS2 is essential for pre-mRNA splicing and is critical for spliceosome activation as a key component of the activated spliceosome and the PRP19-CDC5L complex. It may act as a scaffold in spliceosome assembly, forming contacts with core components. BCAS2 Protein, Human (N-GST) is the recombinant human-derived BCAS2 protein, expressed by E. coli , with N-GST labeled tag.
Background
BCAS2 is essential for pre-mRNA splicing, functioning as a crucial component of the activated spliceosome and the PRP19-CDC5L complex, which is integral to spliceosome activation. It plays a potential scaffolding role in spliceosome assembly by establishing contacts with all other core complex components. The PRP19-CDC5L complex, of which BCAS2 is a part, may also be implicated in the DNA damage response (DDR). BCAS2 is found in both pre-catalytic and catalytic spliceosome complexes, as well as the postcatalytic spliceosome P complex. The PRP19-CDC5L splicing complex, featuring a homotetramer of PRPF19, CDC5L, PLRG1, and BCAS2 as its core, also includes less stably associated proteins like CTNNBL1, CWC15, and HSPA8. BCAS2 directly interacts with PRPF19, CDC5L, and PLRG1 within this complex.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
O75934 (A2-F225)
-
Molecular Construction
-
N-term
-
GST
-
BCAS2 (A2-F225)
Accession # O75934 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
BCAS2; Breast Carcinoma Amplified Sequence 2; BCAS2 Pre-MRNA Processing Factor; Spliceosome-Associated Protein SPF 27; DAM1; Spliceosome Associated Protein, Amplified In Breast Cancer; Pre-MRNA-Splicing Factor SPF27; Breast Carcinoma-Amplified Sequence 2;
-
AA Sequence
AGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
-
Predicted Molecular Mass
53 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HC1, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)