BCORL1 Protein, Human (His, Strep)
BCORL1 Protein, Human (His, Strep) is the recombinant human-derived BCORL1, expressed by E. coli, with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BCORL1 Protein, Human (His, Strep) is the recombinant human-derived BCORL1, expressed by E. coli, with Strep, His labeled tag.
Background
BCORL1 is a transcriptional corepressor that may specifically inhibit gene expression when recruited to promoter regions by sequence-specific DNA-binding proteins such as BCL6. This repression may be mediated, at least in part, by histone deacetylase activities associated with this corepressor.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q5H9F3-1 (D1594-S1711)
-
Gene ID63035
-
Protein Length
Partial
-
Synonyms
BCORL1; FLJ11362; Prev. CXorf10; Alternative Protein BCORL1; BCoR-L1; BCL6 Co-Repressor-Like 1; BCL-6 Corepressor-Like Protein 1; BCORL1 Protein; BCoR-Like Protein 1; SHUVER; BCL6 Corepressor Like 1; Chromosome X Open Reading Frame 10
-
AA Sequence
DDFMFELSDKPLLPCYNLQVSVSRGPCNWFLFSDVLKRLKLSSRIFQARFPHFEITTMPKAEFYRQVASSQLLTPAERPGGLDDRSPPGSSETVELVRYEPDLLRLLGSEVEFQSCNS
-
Predicted Molecular Mass
16.7 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
