BD-4 Protein, Rat
Based on 1 Customer Validation
BD-4 Protein, Rat is an inducible peptide with a broad spectrum antimicrobial activity.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
BD-4 Protein, Rat is an inducible peptide with a broad spectrum antimicrobial activity.
Recombinant Rat Beta Defensin-4 is an inducible peptide with a broad spectrum antimicrobial activity. Human Beta Defensin-4 (hBD-4) expression is up-regulated by infection with gram-positive and gram-negative bacteria in human respiratory epithelial cells, and in response to phorbol 12-myristate 13-acetate, but not in response to other inflammatory factors that up-regulate the expression of hBD-2 or hBD-3[1].
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
O88514 (Q23-K63)
-
Molecular Construction
-
N-term
-
BD-4 (Q23-K63)
Accession # O88514 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
rRtBD-4; DEFB-4; Beta-defensin 104; DEFB4; DEFB104
-
AA Sequence
QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
Lyophilized after extensive dialysis against 10 mM PB, pH 7.4, 500 mM NaCl.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
