Beta-NGF Protein, Mouse (110a.a, His)

Customer Review

Based on 1 Customer Validation

Beta-NGF protein is essential for the development and maintenance of the nervous system and binds to NTRK1 and NGFR receptors to initiate signaling cascades that regulate neuronal processes.The NGF precursor proNGF acts as a ligand for the SORCS2-NGFR receptor and activates pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth.Beta-NGF Protein, Mouse (110a.a, His) is the recombinant mouse-derived Beta-NGF protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Beta-NGF protein is essential for the development and maintenance of the nervous system and binds to NTRK1 and NGFR receptors to initiate signaling cascades that regulate neuronal processes.The NGF precursor proNGF acts as a ligand for the SORCS2-NGFR receptor and activates pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth.Beta-NGF Protein, Mouse (110a.a, His) is the recombinant mouse-derived Beta-NGF protein, expressed by E.coli , with N-6*His labeled tag.

Background

Beta-NGF, a pivotal factor in the development and maintenance of the sympathetic and sensory nervous systems, acts as an extracellular ligand for the NTRK1 and NGFR receptors, triggering cellular signaling cascades that regulate neuronal proliferation, differentiation, and survival. The immature NGF precursor (proNGF) serves as a ligand for the heterodimeric receptor formed by SORCS2 and NGFR, inducing signaling cascades that result in the inactivation of RAC1 and/or RAC2, along with the reorganization of the actin cytoskeleton and subsequent neuronal growth cone collapse. In contrast to mature NGF, proNGF has been identified to promote neuronal apoptosis in vitro. Additionally, Beta-NGF inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binding to lysophosphatidylinositol and lysophosphatidylserine within its homodimeric structure, Beta-NGF exhibits diverse functions in cellular responses, including promoting histamine release from mast cells when in its lipid-bound form. The homodimeric structure of Beta-NGF interacts with NTRK1, NGFR, and SORCS2, while the NGF precursor (proNGF) binds to a receptor complex formed by SORT1 and NGFR, leading to NGF endocytosis. These intricate interactions underscore the multifaceted roles of Beta-NGF in orchestrating neuronal functions and cellular responses.

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 9.125 ng/mL, corresponding to a specific activity is 1.095×10^5 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • Beta-NGF (M130-R239)
      Accession # P01139
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NGF; Beta-NGF; Prev. NGFB; Pro-Nerve Growth Factor Long; Beta-Nerve Growth Factor; HSAN5; Nerve Growth Factor (Beta Polypeptide); Nerve Growth Factor; Nerve Growth Factor, Beta Subunit

  • AA Sequence

    MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR

  • Predicted Molecular Mass

    12.4 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 200 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00