BMF Protein, Human (His)
Based on 1 Customer Validation
BMF proteins may play a key role in apoptosis, with isoform 1 being the major promoter. It interacts with anti-apoptotic proteins (including MCL1, BCL2, BCL2L1/BCL-Xl, BCL2A1 and BCL2L2/BCL-w), suggesting involvement in the regulatory network of cell death. BMF Protein, Human (His) is the recombinant human-derived BMF protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
BMF proteins may play a key role in apoptosis, with isoform 1 being the major promoter. It interacts with anti-apoptotic proteins (including MCL1, BCL2, BCL2L1/BCL-Xl, BCL2A1 and BCL2L2/BCL-w), suggesting involvement in the regulatory network of cell death. BMF Protein, Human (His) is the recombinant human-derived BMF protein, expressed by E. coli , with N-His labeled tag.
Background
The BMF protein is implicated in potentially playing a crucial role in apoptosis, with isoform 1 identified as the primary initiator in this cellular process. BMF interacts with various anti-apoptotic proteins, including MCL1, BCL2, BCL2L1/BCL-Xl, BCL2A1, and BCL2L2/BCL-w, suggesting its involvement in the intricate regulatory network governing cell death. Notably, BMF engages with the myosin V actin motor complex through its binding to DLC2, indicating potential interactions with cytoskeletal elements. These molecular associations highlight the versatility of BMF in participating not only in apoptosis but also in potential interactions with the cellular machinery involved in cytoskeletal dynamics.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q96LC9-1 (M1-R184)
-
Molecular Construction
-
N-term
-
His
-
BMF (M1-R184)
Accession # Q96LC9-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
BMF; Bcl-2-Modifying Factor; Bcl2 Modifying Factor; FLJ00065
-
AA Sequence
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
-
Predicted Molecular Mass
22.3 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris, 0.1% Brij35, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
\
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)