BRAF Protein, Human (Active, sf9, GST, His)

BRAF Protein, Human (Active, sf9, GST, His) is the recombinant human-derived BRAF, expressed by Sf9 insect cells .

BRAF is a protein kinase involved in transducing mitogenic signals from the cell membrane to the nucleus (Probable). It phosphorylates MAP2K1, activating the MAP kinase signal transduction pathway (by similar: PubMed:21441910, PubMed:29433126), and can phosphorylate PFKFB2 (by similar: PubMed:36402789). Additionally, it may play a role in the postsynaptic responses of hippocampal neurons (by similar: PubMed:1508179).

The BRAF activity was detected using Ultra Luminescence technology. The reaction was performed by incubating the BRAF protein, ATP and substrate at 25°C for 60 min, then adding ADP-Glo reagent and reading RLU signal with BMG.

Human

Sf9 insect cells

C-6*His;N-GST

P15056 (E433-R726)

673

Partial

EDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHR

Approximately 61.3 kDa

≥ 80%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.