BRAF Protein, Human (Active, sf9, GST, His)

Customer Review

Based on 1 Customer Validation

BRAF Protein, Human (Active, sf9, GST, His) is the recombinant human-derived BRAF, expressed by Sf9 insect cells .

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

BRAF Protein, Human (Active, sf9, GST, His) is the recombinant human-derived BRAF, expressed by Sf9 insect cells .

Background

BRAF is a protein kinase involved in transducing mitogenic signals from the cell membrane to the nucleus (Probable). It phosphorylates MAP2K1, activating the MAP kinase signal transduction pathway (by similar: PubMed:21441910, PubMed:29433126), and can phosphorylate PFKFB2 (by similar: PubMed:36402789). Additionally, it may play a role in the postsynaptic responses of hippocampal neurons (by similar: PubMed:1508179).

Verified Bioactivity

The BRAF activity was detected using Ultra Luminescence technology. The reaction was performed by incubating the BRAF protein, ATP and substrate at 25°C for 60 min, then adding ADP-Glo reagent and reading RLU signal with BMG.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-6*His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • BRAF (E433-R726)
      Accession # P15056
    • C-term
  • Protein Length

    Partial

  • Synonyms

    BRAF; V-Raf Murine Sarcoma Viral Oncogene-Like Protein B1; B-Raf Proto-Oncogene, Serine/Threonine Kinase; Murine Sarcoma Viral (V-Raf) Oncogene Homolog B1; BRAF1; Serine/Threonine-Protein Kinase B-Raf Variant; BRAF-1; Non-Specific Serine/Threonine Protein

  • AA Sequence

    EDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHR

  • Predicted Molecular Mass

    61.3 kDa

  • Molecular Weight

    Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00