BRAF Protein, Human (Active, sf9, GST, His)
Based on 1 Customer Validation
BRAF Protein, Human (Active, sf9, GST, His) is the recombinant human-derived BRAF, expressed by Sf9 insect cells .
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BRAF Protein, Human (Active, sf9, GST, His) is the recombinant human-derived BRAF, expressed by Sf9 insect cells .
Background
BRAF is a protein kinase involved in transducing mitogenic signals from the cell membrane to the nucleus (Probable). It phosphorylates MAP2K1, activating the MAP kinase signal transduction pathway (by similar: PubMed:21441910, PubMed:29433126), and can phosphorylate PFKFB2 (by similar: PubMed:36402789). Additionally, it may play a role in the postsynaptic responses of hippocampal neurons (by similar: PubMed:1508179).
Verified Bioactivity
The BRAF activity was detected using Ultra Luminescence technology. The reaction was performed by incubating the BRAF protein, ATP and substrate at 25°C for 60 min, then adding ADP-Glo reagent and reading RLU signal with BMG.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-6*His;N-GST
-
Accession
P15056 (E433-R726)
-
Gene ID673
-
Molecular Construction
-
N-term
-
GST
-
BRAF (E433-R726)
Accession # P15056 -
C-term
-
-
Protein Length
Partial
-
Synonyms
BRAF; V-Raf Murine Sarcoma Viral Oncogene-Like Protein B1; B-Raf Proto-Oncogene, Serine/Threonine Kinase; Murine Sarcoma Viral (V-Raf) Oncogene Homolog B1; BRAF1; Serine/Threonine-Protein Kinase B-Raf Variant; BRAF-1; Non-Specific Serine/Threonine Protein
-
AA Sequence
EDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHR
-
Predicted Molecular Mass
61.3 kDa
-
Molecular Weight
Approximately 61 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
