BRD3 Protein, Human (BD2, GST)
BRD3 Protein, Human (BD2, GST) is the recombinant human-derived BRD3, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
Biological Activity
BRD3 Protein, Human (BD2, GST) is the recombinant human-derived BRD3, expressed by E. coli , with N-GST labeled tag.
BRD3 is a chromatin reader that recognizes and binds acetylated histones, thereby controlling gene expression and remodeling chromatin structures. It recruits transcription factors and coactivators to target gene sites and activates RNA polymerase II machinery for transcriptional elongation. In vitro, BRD3 binds acetylated lysine residues on the N-terminus of histones H2A, H2B, H3, and H4. During endoderm differentiation, BRD3 associates with the long non-coding RNA (lncRNA) DIGIT, undergoing liquid-liquid phase separation to promote binding to histone H3 acetylated at Lys-18 (H3K18ac), thereby inducing endoderm gene expression. Additionally, BRD3 binds non-histone acetylated proteins such as GATA1 and GATA2 (by similar): it regulates transcription by promoting the binding of transcription factor GATA1 to its targets.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q15059-1 (G306-D417)
-
Gene ID8019
-
Molecular Construction
-
N-term
-
GST
-
BRD3 (G306-D417)
Accession # Q15059-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
BRD3; Bromodomain-Containing Protein 3; Bromodomain Containing 3; RING3-Like Protein; RING3L; Bromodomain-Containing Protein 3 Short Isoform; KIAA0043; Bromodomain-Containing 3; FSHRG2; Alternative Protein BRD3; ORFX; RING3-Like; Female Sterile Homeotic R
-
AA Sequence
GKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
-
Predicted Molecular Mass
40 kDa
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)