1. Recombinant Proteins
  2. Others
  3. BRDT Protein, Human (His, SUMO)

The BRDT protein is a testis-specific chromatin factor that is essential for acetylated histones and specifically recognizes H4K5ac and H4K8ac. It plays a key role in spermatogenesis by promoting gene activation at specific developmental stages in late pachytene spermatocytes. BRDT Protein, Human (His, SUMO) is the recombinant human-derived BRDT protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BRDT protein is a testis-specific chromatin factor that is essential for acetylated histones and specifically recognizes H4K5ac and H4K8ac. It plays a key role in spermatogenesis by promoting gene activation at specific developmental stages in late pachytene spermatocytes. BRDT Protein, Human (His, SUMO) is the recombinant human-derived BRDT protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

The BRDT protein, a testis-specific chromatin factor, exhibits a distinctive affinity for histone H4 acetylated at 'Lys-5' and 'Lys-8' (H4K5ac and H4K8ac, respectively), playing a pivotal role in spermatogenesis. Essential in late pachytene spermatocytes, BRDT contributes to meiotic and post-meiotic processes by binding to acetylated histones at specific gene promoters, facilitating their activation at the appropriate developmental stages. In the post-meiotic phase, BRDT engages with hyperacetylated histones, participating in their general removal from DNA. Notably, it recognizes and binds a subset of butyrylated histones, specifically targeting H4K8ac. Beyond its chromatin-binding functions, BRDT acts as a component of the splicing machinery in pachytene spermatocytes and round spermatids, participating in 3'-UTR truncation of specific mRNAs in post-meiotic spermatids. Its significance extends to chromocenter organization, a structure comprising peri-centromeric heterochromatin. BRDT establishes interactions with various mRNA splicing machinery proteins, including SRSF2, DDX5, HNRNPK, and TARDBP, as well as with P-TEFb components CDK9 and CCNT1/cyclin-T1. Additionally, it interacts with the acetylated N-terminus of histone H1, H2, H3, and H4, highlighting its intricate involvement in chromatin dynamics and gene regulation during spermatogenesis.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

Q58F21 (N21-E137)

Gene ID

676

Molecular Construction
N-term
6*His-SUMO
BRDT (N21-E137)
Accession # Q58F21
C-term
Protein Length

Partial

Synonyms
BRDT; Bromodomain testis-specific protein; Cancer/testis antigen 9; CT9; RING3-like protein
AA Sequence

NTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BRDT Protein, Human (His, SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BRDT Protein, Human (His, SUMO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BRDT Protein, Human (His, SUMO)
Cat. No.:
HY-P701714
Quantity:
MCE Japan Authorized Agent: