BRDT Protein, Human (His, SUMO)
The BRDT protein is a testis-specific chromatin factor that is essential for acetylated histones and specifically recognizes H4K5ac and H4K8ac. It plays a key role in spermatogenesis by promoting gene activation at specific developmental stages in late pachytene spermatocytes. BRDT Protein, Human (His, SUMO) is the recombinant human-derived BRDT protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The BRDT protein is a testis-specific chromatin factor that is essential for acetylated histones and specifically recognizes H4K5ac and H4K8ac. It plays a key role in spermatogenesis by promoting gene activation at specific developmental stages in late pachytene spermatocytes. BRDT Protein, Human (His, SUMO) is the recombinant human-derived BRDT protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
The BRDT protein, a testis-specific chromatin factor, exhibits a distinctive affinity for histone H4 acetylated at 'Lys-5' and 'Lys-8' (H4K5ac and H4K8ac, respectively), playing a pivotal role in spermatogenesis. Essential in late pachytene spermatocytes, BRDT contributes to meiotic and post-meiotic processes by binding to acetylated histones at specific gene promoters, facilitating their activation at the appropriate developmental stages. In the post-meiotic phase, BRDT engages with hyperacetylated histones, participating in their general removal from DNA. Notably, it recognizes and binds a subset of butyrylated histones, specifically targeting H4K8ac. Beyond its chromatin-binding functions, BRDT acts as a component of the splicing machinery in pachytene spermatocytes and round spermatids, participating in 3'-UTR truncation of specific mRNAs in post-meiotic spermatids. Its significance extends to chromocenter organization, a structure comprising peri-centromeric heterochromatin. BRDT establishes interactions with various mRNA splicing machinery proteins, including SRSF2, DDX5, HNRNPK, and TARDBP, as well as with P-TEFb components CDK9 and CCNT1/cyclin-T1. Additionally, it interacts with the acetylated N-terminus of histone H1, H2, H3, and H4, highlighting its intricate involvement in chromatin dynamics and gene regulation during spermatogenesis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
Q58F21 (N21-E137)
-
Gene ID676
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
BRDT (N21-E137)
Accession # Q58F21 -
C-term
-
-
Protein Length
Partial
-
Synonyms
BRDT; BRD6; Bromodomain Testis Associated; Bromodomain, Testis-Specific; CT9; RING3-Like Protein; Bromodomain Testis-Specific Protein; BRDt; Cancer/Testis Antigen 9; SPGF21
-
AA Sequence
NTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)