BRPF1 Protein, Human (115a.a)
The BRPF1 protein is a key scaffold in HAT complexes such as MOZ/MORF and HBO1, and has histone H3 acetyltransferase activity. In the HBO1 complex, BRPF1 directs the specificity of KAT7/HBO1 for H3K14ac. BRPF1 Protein, Human (115a.a) is the recombinant human-derived BRPF1, expressed by E. coli, with tag-free. The total length of BRPF1 Protein, Human (115a.a) is 115 a.a..
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The BRPF1 protein is a key scaffold in HAT complexes such as MOZ/MORF and HBO1, and has histone H3 acetyltransferase activity. In the HBO1 complex, BRPF1 directs the specificity of KAT7/HBO1 for H3K14ac. BRPF1 Protein, Human (115a.a) is the recombinant human-derived BRPF1, expressed by E. coli, with tag-free. The total length of BRPF1 Protein, Human (115a.a) is 115 a.a..
Background
BRPF1, a pivotal scaffold subunit of histone acetyltransferase (HAT) complexes, such as MOZ/MORF and HBO1, exhibits histone H3 acetyltransferase activity. Within the HBO1 complex, BRPF1 plays a crucial role in directing the specificity of KAT7/HBO1 towards acetylation of histone H3 at 'Lys-14' (H3K14ac). Some HAT complexes, in which BRPF1 participates, preferentially mediate acetylation at histone H3 'Lys-23' (H3K23ac). Beyond its catalytic role, BRPF1 positively regulates the transcription of key genes like RUNX1 and RUNX2. It functions as a key component in the assembly of the HBO1 complex, interacting with KAT7/HBO1, MEAF6, and ING5. Additionally, BRPF1 is integral to the MOZ/MORF complex, collaborating with ING5, KAT6A, KAT6B, and MEAF6. The interaction of BRPF1 with specific histone modifications, such as unmethylated H3 at 'Lys-4' (H3K4me0) and trimethylated 'Lys-36' of histone H3 (H3K36me3), underscores its intricate involvement in chromatin dynamics. Notably, BRPF1 interacts with KAT7, highlighting its association with key players in HAT complexes and emphasizing its multifaceted role in epigenetic regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P55201-1 (M626-G740)
-
Gene ID7862
-
Protein Length
Partial
-
Synonyms
BRPF1; Bromodomain And PHD Finger Containing, 1, Isoform CRA_d; Bromodomain And PHD Finger Containing 1; Bromodomain And PHD Finger-Containing Protein 1; BR140; Bromodomain And PHD Finger Containing, 1; Peregrin; Protein Br140; Bromodomain-Containing Prot
-
AA Sequence
MEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG
-
Predicted Molecular Mass
13.7 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)