BRPF1 Protein, Human (115a.a)

The BRPF1 protein is a key scaffold in HAT complexes such as MOZ/MORF and HBO1, and has histone H3 acetyltransferase activity. In the HBO1 complex, BRPF1 directs the specificity of KAT7/HBO1 for H3K14ac. BRPF1 Protein, Human (115a.a) is the recombinant human-derived BRPF1, expressed by E. coli, with tag-free. The total length of BRPF1 Protein, Human (115a.a) is 115 a.a..

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The BRPF1 protein is a key scaffold in HAT complexes such as MOZ/MORF and HBO1, and has histone H3 acetyltransferase activity. In the HBO1 complex, BRPF1 directs the specificity of KAT7/HBO1 for H3K14ac. BRPF1 Protein, Human (115a.a) is the recombinant human-derived BRPF1, expressed by E. coli, with tag-free. The total length of BRPF1 Protein, Human (115a.a) is 115 a.a..

Background

BRPF1, a pivotal scaffold subunit of histone acetyltransferase (HAT) complexes, such as MOZ/MORF and HBO1, exhibits histone H3 acetyltransferase activity. Within the HBO1 complex, BRPF1 plays a crucial role in directing the specificity of KAT7/HBO1 towards acetylation of histone H3 at 'Lys-14' (H3K14ac). Some HAT complexes, in which BRPF1 participates, preferentially mediate acetylation at histone H3 'Lys-23' (H3K23ac). Beyond its catalytic role, BRPF1 positively regulates the transcription of key genes like RUNX1 and RUNX2. It functions as a key component in the assembly of the HBO1 complex, interacting with KAT7/HBO1, MEAF6, and ING5. Additionally, BRPF1 is integral to the MOZ/MORF complex, collaborating with ING5, KAT6A, KAT6B, and MEAF6. The interaction of BRPF1 with specific histone modifications, such as unmethylated H3 at 'Lys-4' (H3K4me0) and trimethylated 'Lys-36' of histone H3 (H3K36me3), underscores its intricate involvement in chromatin dynamics. Notably, BRPF1 interacts with KAT7, highlighting its association with key players in HAT complexes and emphasizing its multifaceted role in epigenetic regulation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    BRPF1; Bromodomain And PHD Finger Containing, 1, Isoform CRA_d; Bromodomain And PHD Finger Containing 1; Bromodomain And PHD Finger-Containing Protein 1; BR140; Bromodomain And PHD Finger Containing, 1; Peregrin; Protein Br140; Bromodomain-Containing Prot

  • AA Sequence

    MEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG

  • Predicted Molecular Mass

    13.7 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00