BRPF1 Protein, Human (115a.a)

The BRPF1 protein is a key scaffold in HAT complexes such as MOZ/MORF and HBO1, and has histone H3 acetyltransferase activity. In the HBO1 complex, BRPF1 directs the specificity of KAT7/HBO1 for H3K14ac. BRPF1 Protein, Human (115a.a) is the recombinant human-derived BRPF1, expressed by E. coli, with tag-free. The total length of BRPF1 Protein, Human (115a.a) is 115 a.a..

BRPF1, a pivotal scaffold subunit of histone acetyltransferase (HAT) complexes, such as MOZ/MORF and HBO1, exhibits histone H3 acetyltransferase activity. Within the HBO1 complex, BRPF1 plays a crucial role in directing the specificity of KAT7/HBO1 towards acetylation of histone H3 at 'Lys-14' (H3K14ac). Some HAT complexes, in which BRPF1 participates, preferentially mediate acetylation at histone H3 'Lys-23' (H3K23ac). Beyond its catalytic role, BRPF1 positively regulates the transcription of key genes like RUNX1 and RUNX2. It functions as a key component in the assembly of the HBO1 complex, interacting with KAT7/HBO1, MEAF6, and ING5. Additionally, BRPF1 is integral to the MOZ/MORF complex, collaborating with ING5, KAT6A, KAT6B, and MEAF6. The interaction of BRPF1 with specific histone modifications, such as unmethylated H3 at 'Lys-4' (H3K4me0) and trimethylated 'Lys-36' of histone H3 (H3K36me3), underscores its intricate involvement in chromatin dynamics. Notably, BRPF1 interacts with KAT7, highlighting its association with key players in HAT complexes and emphasizing its multifaceted role in epigenetic regulation.

Human

E. coli

Tag Free

P55201-1 (M626-G740)

7862

Partial

MEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.