BTN3A1/CD277 Protein, Human (HEK293)
Based on 1 Customer Validation
BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (HEK293) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (HEK293) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with tag free.
Background
The BTN3A1/CD277 protein is involved in crucial functions related to T-cell activation and the adaptive immune response. It acts as a regulator of activated T-cell proliferation and controls the release of cytokines and IFNG by these cells. Additionally, it plays a role in mediating the response of T-cells towards infected and transformed cells that exhibit elevated levels of phosphorylated metabolites, such as isopentenyl pyrophosphate. The BTN3A1/CD277 protein functions as a homodimer.
Verified Bioactivity
Immobilized Human BTN3A1, No Tag at 0.5 μg/mL(100 μl/well) on the plate. Dose response curve for Anti-BTN3A1 Antibody, hFc Tag with the EC50 of 8.8 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
O00481-1 (Q30-G254)
-
Molecular Construction
-
N-term
-
BTN3A1 (Q30-G254)
Accession # O00481-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
BTN3A1; CD277; Butyrophilin Subfamily 3 Member A1; DJ45P21.3 (Butyrophilin, Subfamily 3, Member A1); BTF5; Butyrophilin, Subfamily 3, Member A1; BTN3.1; CD277 Antigen; BT3.1
-
AA Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG
-
Predicted Molecular Mass
24.2 kDa
-
Molecular Weight
Approximately 26-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
