Copy Link Print Information

C1s-A subcomponent Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

C1s-A subcomponent protein, a serine protease, is pivotal in the classical complement system pathway. Partnering with C1q and C1r, it forms C1, initiating complement activation. Activated by C1r, C1s can subsequently trigger downstream components C2 and C4, influencing the complement system cascade. C1s-A subcomponent, Mouse (HEK293, His) is the recombinant mouse-derived C1s-A subcomponent protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for C1s-A subcomponent Protein, Mouse (HEK293, His)
  • C1s-A subcomponent Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

C1s-A subcomponent protein, a serine protease, is pivotal in the classical complement system pathway. Partnering with C1q and C1r, it forms C1, initiating complement activation. Activated by C1r, C1s can subsequently trigger downstream components C2 and C4, influencing the complement system cascade. C1s-A subcomponent, Mouse (HEK293, His) is the recombinant mouse-derived C1s-A subcomponent protein, expressed by HEK293, with C-His labeled tag.

Background

C1s-A subcomponent protein is a serine protease that plays a crucial role in the classical pathway of the complement system. It associates with C1q and C1r to form C1, the initiating component of this pathway. Upon activation by C1r, C1s becomes capable of activating downstream components C2 and C4, contributing to the cascade of events in the complement system.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession

    Q8CG14 (E16-D688)

  • Gene ID
    50908
  • Molecular Construction
    • N-term
    • C1s1 (E16-D688)
      Accession # Q8CG14
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    C1sa; C1s; C1s1; Complement C1s-A subcomponent light chain; Complement C1s-A subcomponent heavy chain; Complement component 1, S subcomponent 1; Complement component 1 subcomponent s-A; Complement C1s-A subcomponent; C1 esterase; EC:3.4.21.42; Complement

  • AA Sequence

    EPTMHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIHLYFTHVDIEPSESCAYDSVQIISGGIEEGRLCGQKTSKSPNSPIIEEFQFPYNKLQVVFTSDFSNEERFTGFAAYYTAIDINECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVNCSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTMQREDFDVEPADSEGNCPDSLTFASKNQQFGPYCGNGFPGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDPISCAKKITANSTWEPDKAKYVFKDVVKITCVDGFEVVEGHVSSTSYYSTCQSDGQWSNSGLKCQPVYCGIPDPIANGKVEEPENSVFGTVVHYTCEEPYYYMEHEEGGEYRCAANGRWVNDQLGIELPRCIPACGVPTEPFQVHQRIFGGQPAKIENFPWQVFFNHPRASGALINEYWVLTAAHVLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDNMICAGEKGVDSCHGDSGGAFAFQVPNVTVPKFYVAGLVSWGKRCGTYGVYTKVKNYVDWILKTMQENSGPRKD

  • Predicted Molecular Mass

    76.6 kDa

  • Molecular Weight

    Approximately 35-38 kDa & 60-95 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • C1s-A subcomponent Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for C1s-A subcomponent Protein, Mouse (HEK293, His)
  • C1s-A subcomponent Protein, Mouse (HEK293, His) Product Image