CA125 Protein, Human (HEK293, His-Avi)

The CA125 protein acts by binding to MSLN and plays a crucial role in forming a protective and lubricating barrier on mucosal surfaces. This interaction promotes heterotypic cell adhesion and is suggested to play an important role in peritoneal metastasis of ovarian cancer. CA125 Protein, Human (HEK293, His-Avi) is the recombinant human-derived CA125 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

CA125 protein is believed to serve a crucial role in establishing a protective and lubricating barrier against particles and infectious agents at mucosal surfaces. It exerts its functions through binding to MSLN, where the interaction mediates heterotypic cell adhesion. This adhesive property may play a significant role in the metastasis of ovarian cancer to the peritoneum, as CA125 initiates cell attachment to the mesothelial epithelium by binding to MSLN. The interaction between CA125 and MSLN underscores its potential involvement in the adhesive events associated with cancer metastasis, particularly in the context of ovarian cancer progression to the peritoneal cavity.

Human

HEK293

C-Avi;C-8*His

Q8WXI7 (G12660-M12923)

94025  [NCBI]

Partial

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM

Approximately 55-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.