CALB1 Protein, Human (His, Strep)
CALB1 Protein, Human (His, Strep) is the recombinant human-derived CALB1, expressed by E. coli, with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CALB1 Protein, Human (His, Strep) is the recombinant human-derived CALB1, expressed by E. coli, with Strep, His labeled tag.
Calbindin is a calcium-binding protein that primarily buffers cytosolic calcium ions. It may regulate calcium signaling pathways by stimulating a membrane Ca2+-ATPase and a 3',5'-cyclic nucleotide phosphodiesterase.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P05937 (A2-N261)
-
Gene ID793
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CALB1; Calbindin D28; Prev. CALB; Vitamin D-Dependent Calcium Binding Protein Calbindin; Calbindin; Calbindin 1, (28kD); Vitamin D-Dependent Calcium-Binding Protein, Avian-Type; RTVL-H Protein; Calbindin 1, 28kDa; Calbindin 27; Calbindin-D28k; CAB27; Calb
-
AA Sequence
AESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
-
Predicted Molecular Mass
33.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
