CART Protein, Human (HEK293)

Customer Review

Based on 1 Customer Validation

CART Protein, a satiety factor, intricately regulates feeding in connection with leptin and neuropeptide Y. It effectively suppresses regular and starvation-triggered feeding, robustly inhibiting neuropeptide Y-initiated feeding within the hypothalamus. Additionally, CART protein plays a pivotal role in fostering neuronal development and survival in vitro, extending beyond its appetite regulation function. CART Protein, Human (HEK293) is the recombinant human-derived CART protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CART Protein, a satiety factor, intricately regulates feeding in connection with leptin and neuropeptide Y. It effectively suppresses regular and starvation-triggered feeding, robustly inhibiting neuropeptide Y-initiated feeding within the hypothalamus. Additionally, CART protein plays a pivotal role in fostering neuronal development and survival in vitro, extending beyond its appetite regulation function. CART Protein, Human (HEK293) is the recombinant human-derived CART protein, expressed by HEK293 , with tag free.

Background

CART protein, a satiety factor intricately linked to the functions of leptin and neuropeptide Y, acts as an anorectic peptide by effectively suppressing both regular and starvation-triggered feeding. Furthermore, it robustly inhibits the feeding response initiated by neuropeptide Y and governed by leptin within the hypothalamus. Beyond its role in appetite regulation, CART protein also plays a pivotal role in fostering neuronal development and survival when studied in vitro.

Verified Bioactivity

Measured by its ability to enhance proliferation of SH-SY5Y cells. The ED50 for this effect is 1.221 μg/mL, corresponding to a specific activity is 819.001 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CART (Q28-L116)
      Accession # Q16568
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CARTPT; Cocaine- And Amphetamine-Regulated Transcript Protein; CART Prepropeptide; Cocaine And Amphetamine Regulated Transcript; CART

  • AA Sequence

    QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00