CART Protein, Human (HEK293)
Based on 1 Customer Validation
CART Protein, a satiety factor, intricately regulates feeding in connection with leptin and neuropeptide Y. It effectively suppresses regular and starvation-triggered feeding, robustly inhibiting neuropeptide Y-initiated feeding within the hypothalamus. Additionally, CART protein plays a pivotal role in fostering neuronal development and survival in vitro, extending beyond its appetite regulation function. CART Protein, Human (HEK293) is the recombinant human-derived CART protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CART Protein, a satiety factor, intricately regulates feeding in connection with leptin and neuropeptide Y. It effectively suppresses regular and starvation-triggered feeding, robustly inhibiting neuropeptide Y-initiated feeding within the hypothalamus. Additionally, CART protein plays a pivotal role in fostering neuronal development and survival in vitro, extending beyond its appetite regulation function. CART Protein, Human (HEK293) is the recombinant human-derived CART protein, expressed by HEK293 , with tag free.
Background
CART protein, a satiety factor intricately linked to the functions of leptin and neuropeptide Y, acts as an anorectic peptide by effectively suppressing both regular and starvation-triggered feeding. Furthermore, it robustly inhibits the feeding response initiated by neuropeptide Y and governed by leptin within the hypothalamus. Beyond its role in appetite regulation, CART protein also plays a pivotal role in fostering neuronal development and survival when studied in vitro.
Verified Bioactivity
Measured by its ability to enhance proliferation of SH-SY5Y cells. The ED50 for this effect is 1.221 μg/mL, corresponding to a specific activity is 819.001 units/mg.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q16568/NP_004282.1 (Q28-L116)
-
Molecular Construction
-
N-term
-
CART (Q28-L116)
Accession # Q16568 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CARTPT; Cocaine- And Amphetamine-Regulated Transcript Protein; CART Prepropeptide; Cocaine And Amphetamine Regulated Transcript; CART
-
AA Sequence
QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)