1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin E
  5. Cathepsin E Protein, Rat (HEK293, His)

Cathepsin E Protein is an aspartate protease that plays an important role in protein degradation, bioactive protein production and antigen processing.The Cathepsin E Protein is involved in the execution of age-induced neuronal death pathways, as well as overstimulation of glutamate receptors by excitotoxins and transient forebrain ischemia.Cathepsin E Protein is a potential early biomarker of pancreatic ductal adenocarcinoma (PDAC).Cathepsin E Protein, Rat (HEK293, His) is the recombinant rat-derived Cathepsin E protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cathepsin E Protein is an aspartate protease that plays an important role in protein degradation, bioactive protein production and antigen processing.The Cathepsin E Protein is involved in the execution of age-induced neuronal death pathways, as well as overstimulation of glutamate receptors by excitotoxins and transient forebrain ischemia.Cathepsin E Protein is a potential early biomarker of pancreatic ductal adenocarcinoma (PDAC).Cathepsin E Protein, Rat (HEK293, His) is the recombinant rat-derived Cathepsin E protein, expressed by HEK293 , with C-His labeled tag.

Background

Cathepsin E is an aspartic protease and member of the peptidase A1 protease family, expressed primarily in the immune system, gastrointestinal system, lymphoid tissue, red blood cells and cancer cells. Cathepsin E decomposes proteins by hydrolyzing peptide bonds at specific peptide sequence sites and plays an important role in protein degradation, bioactive protein production and antigen processing. Cathepsin E is involved in the execution of age-induced neuronal death pathways, as well as overstimulation of glutamate receptors by excitotoxins and transient forebrain ischemia. Cathepsin E may play a role in intestinal metaplasia and differentiation into highly differentiated adenocarcinomas and in dendritic cells[1][2][3][4].

Species

Rat

Source

HEK293

Tag

C-His

Accession

AAH62002 (V22-P398)

Gene ID
Molecular Construction
N-term
Cathepsin E (V22-P398)
Accession # AAH62002
His
C-term
Protein Length

Full Length

Synonyms
Cathepsin E; CTSE; CATE
AA Sequence

VLHRVPLRRHQSLRKKLRAQGQLSDFWRSHNLDVIEFSESCNVDKGINEPLINYLDMEYFGTVSIGSPSQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSSTYMEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVEGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQGYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPKKIKQLQEAIGATPMDGEYAVDCATLNMMPNVTFLINGVSYTLSPTAYILPDLVDGMQFCGSGFQGLDIQPPAGPLWILGDVFIRKFYSVFDRGNNQVGLAPAVP

Predicted Molecular Mass
42.1 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Cathepsin E Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Cathepsin E Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin E Protein, Rat (HEK293, His)
Cat. No.:
HY-P74344
Quantity:
MCE Japan Authorized Agent: