Cathepsin E Protein, Rat (HEK293, His)

Cathepsin E Protein is an aspartate protease that plays an important role in protein degradation, bioactive protein production and antigen processing.The Cathepsin E Protein is involved in the execution of age-induced neuronal death pathways, as well as overstimulation of glutamate receptors by excitotoxins and transient forebrain ischemia.Cathepsin E Protein is a potential early biomarker of pancreatic ductal adenocarcinoma (PDAC).Cathepsin E Protein, Rat (HEK293, His) is the recombinant rat-derived Cathepsin E protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Cathepsin E Protein is an aspartate protease that plays an important role in protein degradation, bioactive protein production and antigen processing.The Cathepsin E Protein is involved in the execution of age-induced neuronal death pathways, as well as overstimulation of glutamate receptors by excitotoxins and transient forebrain ischemia.Cathepsin E Protein is a potential early biomarker of pancreatic ductal adenocarcinoma (PDAC).Cathepsin E Protein, Rat (HEK293, His) is the recombinant rat-derived Cathepsin E protein, expressed by HEK293 , with C-His labeled tag.

Background

Cathepsin E is an aspartic protease and member of the peptidase A1 protease family, expressed primarily in the immune system, gastrointestinal system, lymphoid tissue, red blood cells and cancer cells. Cathepsin E decomposes proteins by hydrolyzing peptide bonds at specific peptide sequence sites and plays an important role in protein degradation, bioactive protein production and antigen processing. Cathepsin E is involved in the execution of age-induced neuronal death pathways, as well as overstimulation of glutamate receptors by excitotoxins and transient forebrain ischemia. Cathepsin E may play a role in intestinal metaplasia and differentiation into highly differentiated adenocarcinomas and in dendritic cells[1][2][3][4].

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Cathepsin E (V22-P398)
      Accession # AAH62002
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CTSE; Slow-Moving Proteinase; Cathepsin E; CATE; Erythrocyte Membrane Aspartic Proteinase

  • AA Sequence

    VLHRVPLRRHQSLRKKLRAQGQLSDFWRSHNLDVIEFSESCNVDKGINEPLINYLDMEYFGTVSIGSPSQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSSTYMEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVEGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQGYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPKKIKQLQEAIGATPMDGEYAVDCATLNMMPNVTFLINGVSYTLSPTAYILPDLVDGMQFCGSGFQGLDIQPPAGPLWILGDVFIRKFYSVFDRGNNQVGLAPAVP

  • Predicted Molecular Mass

    42.1 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00