Cathepsin E Protein, Rat (HEK293, His)
Cathepsin E Protein is an aspartate protease that plays an important role in protein degradation, bioactive protein production and antigen processing.The Cathepsin E Protein is involved in the execution of age-induced neuronal death pathways, as well as overstimulation of glutamate receptors by excitotoxins and transient forebrain ischemia.Cathepsin E Protein is a potential early biomarker of pancreatic ductal adenocarcinoma (PDAC).Cathepsin E Protein, Rat (HEK293, His) is the recombinant rat-derived Cathepsin E protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Cathepsin E Protein is an aspartate protease that plays an important role in protein degradation, bioactive protein production and antigen processing.The Cathepsin E Protein is involved in the execution of age-induced neuronal death pathways, as well as overstimulation of glutamate receptors by excitotoxins and transient forebrain ischemia.Cathepsin E Protein is a potential early biomarker of pancreatic ductal adenocarcinoma (PDAC).Cathepsin E Protein, Rat (HEK293, His) is the recombinant rat-derived Cathepsin E protein, expressed by HEK293 , with C-His labeled tag.
Cathepsin E is an aspartic protease and member of the peptidase A1 protease family, expressed primarily in the immune system, gastrointestinal system, lymphoid tissue, red blood cells and cancer cells. Cathepsin E decomposes proteins by hydrolyzing peptide bonds at specific peptide sequence sites and plays an important role in protein degradation, bioactive protein production and antigen processing. Cathepsin E is involved in the execution of age-induced neuronal death pathways, as well as overstimulation of glutamate receptors by excitotoxins and transient forebrain ischemia. Cathepsin E may play a role in intestinal metaplasia and differentiation into highly differentiated adenocarcinomas and in dendritic cells[1][2][3][4].
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
AAH62002 (V22-P398)
-
Molecular Construction
-
N-term
-
Cathepsin E (V22-P398)
Accession # AAH62002 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CTSE; Slow-Moving Proteinase; Cathepsin E; CATE; Erythrocyte Membrane Aspartic Proteinase
-
AA Sequence
VLHRVPLRRHQSLRKKLRAQGQLSDFWRSHNLDVIEFSESCNVDKGINEPLINYLDMEYFGTVSIGSPSQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSSTYMEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVEGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQGYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPKKIKQLQEAIGATPMDGEYAVDCATLNMMPNVTFLINGVSYTLSPTAYILPDLVDGMQFCGSGFQGLDIQPPAGPLWILGDVFIRKFYSVFDRGNNQVGLAPAVP
-
Predicted Molecular Mass
42.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)