CCDC134 Protein, Human (HEK293, His)
CCDC134 Protein, Human (HEK293, His) is a cytokine-like molecule that exerts antitumor effects by augmenting CD8+ T-cell mediated immunity.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CCDC134 Protein, Human (HEK293, His) is a cytokine-like molecule that exerts antitumor effects by augmenting CD8+ T-cell mediated immunity.
Background
Coiled-coil domain containing 134 (CCDC134) is a classical secreted protein that inhibited Elk1 transcription regulation and MAPK signal transduction through the Raf-1/MEK/ERK and JNK/SAPK pathway. Also, CCDC134 was identified as a candidate biomarker of gastric cancer, and targeted siRNA knockdown of CCDC134 inhibit tumor migration and invasion via MAPK pathway. CCDC134 might serve as a potential immune cytokine to directly augment CD8+T-cell activation, proliferation and antigen-specific cytotoxicity via the JAK3-STAT5 signaling pathway, and that CCDC134 showed potent antitumor effects via a CD8+ T-cell-dependent manner. CCDC134 exerts potent anti-inflammatory effects through the selective modulation of pathogenic Th1 and Th17 cells by targeting critical signaling pathways[1].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9H6E4 (T23-L229)
-
Molecular Construction
-
N-term
-
CCDC134 (T23-L229)
Accession # Q9H6E4 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCDC134; FLJ22349; Coiled-Coil Domain Containing 134; OI22; Coiled-Coil Domain-Containing Protein 134
-
AA Sequence
TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL
-
Predicted Molecular Mass
25.3 kDa
-
Molecular Weight
Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
