CCDC134 Protein, Human (HEK293, His)

CCDC134 Protein, Human (HEK293, His) is a cytokine-like molecule that exerts antitumor effects by augmenting CD8⁺ T-cell mediated immunity.

Coiled-coil domain containing 134 (CCDC134) is a classical secreted protein that inhibited Elk1 transcription regulation and MAPK signal transduction through the Raf-1/MEK/ERK and JNK/SAPK pathway. Also, CCDC134 was identified as a candidate biomarker of gastric cancer, and targeted siRNA knockdown of CCDC134 inhibit tumor migration and invasion via MAPK pathway. CCDC134 might serve as a potential immune cytokine to directly augment CD8+T-cell activation, proliferation and antigen-specific cytotoxicity via the JAK3-STAT5 signaling pathway, and that CCDC134 showed potent antitumor effects via a CD8⁺ T-cell-dependent manner. CCDC134 exerts potent anti-inflammatory effects through the selective modulation of pathogenic Th1 and Th17 cells by targeting critical signaling pathways^[1].

Human

HEK293

C-6*His

Q9H6E4 (T23-L229)

79879  [NCBI]

TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSELHHHHHH

28-33 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Peng Xia, et al. CCDC134 ameliorated experimental autoimmune encephalomyelitis by suppressing Th1 and Th17 cells. Brain Behav Immun. 2018 Jul;71:158-168.  [Content Brief]