TECK/CCL25 Protein, Mouse
Based on 1 Customer Validation
The CCL25 protein emerged as a potential coordinator of T cell development, suggesting its involvement in the complex process of T cell maturation. Its recombinant form exhibits chemotactic activity against various immune cell types, including thymocytes and macrophages, by binding to the chemokine receptor CCR9. TECK/CCL25 Protein, Mouse is the recombinant mouse-derived TECK/CCL25 protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The CCL25 protein emerged as a potential coordinator of T cell development, suggesting its involvement in the complex process of T cell maturation. Its recombinant form exhibits chemotactic activity against various immune cell types, including thymocytes and macrophages, by binding to the chemokine receptor CCR9. TECK/CCL25 Protein, Mouse is the recombinant mouse-derived TECK/CCL25 protein, expressed by E. coli , with tag free.
CCL25 Protein emerges as a potential participant in T-cell development, suggesting a role in orchestrating the intricate processes associated with T-cell maturation. The recombinant form of CCL25 displays chemotactic activity on various immune cell types, including thymocytes, macrophages, THP-1 cells, and dendritic cells, while remaining inactive on peripheral blood lymphocytes and neutrophils. The protein exerts its effects by binding to the chemokine receptor CCR9, indicating its involvement in directing the migration of specific cell populations. Additionally, CCL25 binds to the atypical chemokine receptor ACKR4, facilitating the recruitment of beta-arrestin (ARRB1/2) to ACKR4. This diverse range of interactions underscores the potential regulatory role of CCL25 in immune cell trafficking and suggests its importance in the orchestration of immune responses and T-cell-related processes.
Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR9 .The ED50 for this effect is 0.1269μg/mL, corresponding to a specific activity is 7880.221 U/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
O35903 (Q24-N144)
-
Molecular Construction
-
N-term
-
CCL25 (Q24-N144)
Accession # O35903 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL25; Ckb15; Prev. SCYA25; Chemokine (C-C Motif) Ligand 25; TECK; Thymus Expressed Chemokine; Small-Inducible Cytokine A25; Thymus-Expressed Chemokine; C-C Motif Chemokine 25; Ck Beta-15; Chemokine TECK; TECKvar; C-C Motif Chemokine Ligand 25; Small Indu
-
AA Sequence
QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
-
Predicted Molecular Mass
14.2 kDa
-
Molecular Weight
Approximately 14-16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
