CD151 Protein-VLP, Human (HEK293)
CD151 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
CD151 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
CD151 is a structural component of tetraspanin-enriched microdomains (TERMs), serving as platforms for receptor clustering and signaling. Through interactions with both integrin and non-integrin proteins, it participates in various cellular and molecular mechanisms, including cell-to-cell communication, wound healing, platelet aggregation, trafficking, cell motility, and angiogenesis. By associating with JAM-A/F11R and integrin ITGA3:ITGB1, CD151 facilitates the recruitment of signaling molecules such as RAC1, CDC42, and RhoGTPases, promoting epithelial cell polarization and actin cytoskeleton reorganization—critical steps in cell migration. It also regulates the glycosylation pattern of ITGA3:ITGB1 to modulate its activity and plays a vital role in maintaining the stability of central laminin-binding integrin ITGA6:ITGB4-containing adhesion complexes. Furthermore, CD151 is essential for the proper assembly of glomerular and tubular basement membranes in the kidney and enhances T-cell activation by modulating integrin signaling, leading to downstream activation of PTK2 and MAPK1/MAPK3. In microbial infections, CD151 contributes to human papillomavirus 16/HPV-16 endocytosis and facilitates human cytomegalovirus entry into host cells by influencing receptor binding, membrane fusion, or capsid release.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P48509 (G2-Y253)
-
Gene ID977
-
Molecular Construction
-
N-term
-
CD151 (G2-Y253)
Accession # P48509 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CD151; SFA-1; CD151 Molecule (Raph Blood Group); GP27; TSPAN24; CD151 Antigen (Raph Blood Group), Isoform CRA_b; PETA-3; Platelet-Endothelial Cell Tetraspan Antigen 3; CD151 Antigen; Platelet Surface Glycoprotein Gp27; RAPH; CDNA FLJ26859 Fis, Clone PRS08
-
AA Sequence
GEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY
-
Purity
Purity analysis by SDS-PAGE is not available for VLP proteins.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)