PVR/CD155 Protein, Mouse (HEK293, His)

PVR/CD155 Protein, Mouse (HEK293, His) is a recombinant mouse CD155 expressed in HEK 293 cells with a His tag at the N-terminus. CD155 Protein plays a role in cancer cell invasion and migration.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

PVR/CD155 Protein, Mouse (HEK293, His) is a recombinant mouse CD155 expressed in HEK 293 cells with a His tag at the N-terminus. CD155 Protein plays a role in cancer cell invasion and migration[1][2].

Background

PVR/CD155, also known as the human poliovirus receptor (PVR) is a member of the subfamily of immunoglobulin (Ig)-like molecules composed of an N-terminal variable-like, followed by two constant-like extracellular domains, a single transmembrane region and a cytoplasmic tail of variable length. CD155 binds the extracellular matrix protein vitronectin thereby mediating cell to matrix contacts. The cytoplasmic tail of CD155 interacts with the μ1B subunit of the clathrin adaptor complex resulting in directed transport of CD155 in polarized epithelial cells[1][2].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PVR (D29-L348)
      Accession # Q8K094
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PVR; Tage4; Prev. PVS; Nectin-Like Protein 5; Poliovirus Receptor; Poliovirus Receptor, Isoform CRA_c; Necl-5; Nectin-Like 5; CD155; CD155 Antigen; NECL5; NECL-5; PVR Cell Adhesion Molecule; HVED

  • AA Sequence

    DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHL

  • Molecular Weight

    Approximately 55-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00