CD158d/KIR2DL4 Protein, Human (HEK293, His)

CD158d/KIR2DL4 Protein, Human (HEK293, His) is a recombinant human CD158d expressed in HEK 293 cells with a His tag at the N-terminus. CD158d/KIR2DL4 Protein is an NK cell-activating receptor with inhibitory potential^[1][2].

KIR2DL4 is the most distinct gene in the KIR family. KIR2DL4 is composed of D0 and D2 Ig-like domains (D0 is the first Ig-like domain of the KIR3D subfamily). The KIR2DL4 promoter differs substantially from all other KIR genes, and both alleles are expressed in essentially all activated NK cells. KIR2DL4 is constitutively expressed only on the surface of the CD56bright subset of peripheral blood NK cells. KIR2DL4 associates with the FcεRIγ adapter protein, but not with DAP12 and has a functional ITIM in its cytoplasmic domain. Despite the presence of an ITIM, cross-linking KIR2DL4 with mAb induces the production of IFN-γ in resting NK cells and triggers cytotoxicity and IFN-γ production in IL-2-activated NK cells^[1][2].

Human

HEK293

C-6*His

ADY38409.1 (W22-H242)

3805  [NCBI]

WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH

Approximately 30-40 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Faure M, et, al. KIR2DL4 (CD158d), an NK cell-activating receptor with inhibitory potential. J Immunol. 2002 Jun 15;168(12):6208-14.  [Content Brief]

  [2]. Lanier LL. NK cell recognition. Annu Rev Immunol. 2005;23:225-74.  [Content Brief]