CD158d/KIR2DL4 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CD158d/KIR2DL4 Protein, Human (HEK293, His) is a recombinant human CD158d expressed in HEK 293 cells with a His tag at the N-terminus. CD158d/KIR2DL4 Protein is an NK cell-activating receptor with inhibitory potential.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CD158d/KIR2DL4 Protein, Human (HEK293, His) is a recombinant human CD158d expressed in HEK 293 cells with a His tag at the N-terminus. CD158d/KIR2DL4 Protein is an NK cell-activating receptor with inhibitory potential[1][2].
Background
KIR2DL4 is the most distinct gene in the KIR family. KIR2DL4 is composed of D0 and D2 Ig-like domains (D0 is the first Ig-like domain of the KIR3D subfamily). The KIR2DL4 promoter differs substantially from all other KIR genes, and both alleles are expressed in essentially all activated NK cells. KIR2DL4 is constitutively expressed only on the surface of the CD56bright subset of peripheral blood NK cells. KIR2DL4 associates with the FcεRIγ adapter protein, but not with DAP12 and has a functional ITIM in its cytoplasmic domain. Despite the presence of an ITIM, cross-linking KIR2DL4 with mAb induces the production of IFN-γ in resting NK cells and triggers cytotoxicity and IFN-γ production in IL-2-activated NK cells[1][2].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
ADY38409.1 (W22-H242)
-
Molecular Construction
-
N-term
-
KIR2DL4 (W22-H242)
Accession # ADY38409.1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
KIR2DL4; Natural Killer Cell Recpetor; Killer Cell Immunoglobulin Like Receptor, Two Ig Domains And Long Cytoplasmic Tail 4; Natural Killer Cell Receptor; CD158D; Truncated NK Cell Receptor; Killer Cell Immunoglobulin-Like Receptor 2DL4; KIR2DL4_00201 Pro
-
AA Sequence
WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
