CD160 Protein, Human (HEK293, His-Avi)
The CD160 protein is found on immune cells and acts as a receptor that transmits stimulatory or inhibitory signals, complexly regulating cell activation and differentiation. It exists in a GPI-anchored and transmembrane form and may initiate different signaling pathways in NK cells and T cells. CD160 Protein, Human (HEK293, His-Avi) is the recombinant human-derived CD160 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD160 protein is found on immune cells and acts as a receptor that transmits stimulatory or inhibitory signals, complexly regulating cell activation and differentiation. It exists in a GPI-anchored and transmembrane form and may initiate different signaling pathways in NK cells and T cells. CD160 Protein, Human (HEK293, His-Avi) is the recombinant human-derived CD160 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
CD160 Protein, found on immune cells, serves as a receptor capable of delivering stimulatory or inhibitory signals that intricately regulate cell activation and differentiation. Existing in both GPI-anchored and transmembrane forms, each likely initiating distinct signaling pathways in activated NK cells via phosphoinositide 3-kinase and in activated T cells via LCK and CD247/CD3 zeta chain. It acts as a receptor for both classical and non-classical MHC class I molecules, recognizing HLA-C during acute viral infections and triggering NK cell cytotoxic activity, contributing to the anti-viral innate immune response. On CD8+ T cells, CD160 binds HLA-A2-B2M, providing a costimulatory signal to activated/memory T cells. However, during persistent antigen stimulation, as observed in chronic viral infections, it may progressively inhibit TCR signaling in memory CD8+ T cells, contributing to T cell exhaustion. On endothelial cells, CD160 recognizes HLA-G, controlling angiogenesis in immune privileged sites. It also acts as a receptor or ligand for TNFRSF14, participating in bidirectional cell-cell contact signaling between antigen-presenting cells and lymphocytes, modulating immune responses in various contexts, including anti-tumor responses and bacterial infections. The soluble GPI-cleaved form, typically released by activated lymphocytes, might play a role in immune regulation by limiting lymphocyte effector functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
O95971-1 (G25-L158)
-
Molecular Construction
-
N-term
-
CD160 (G25-L158)
Accession # O95971-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Full Length of CD161 antigen Chain
-
Synonyms
CD160; NK28; CD160 Molecule; NK1; CD160 Antigen; Natural Killer Cell Receptor, Immunoglobulin Superfamily Member; BY55; CD160-Delta Ig; Natural Killer Cell Receptor BY55
-
AA Sequence
GCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTL
-
Predicted Molecular Mass
17.7 kDa
-
Molecular Weight
Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)