CD200 Protein, Cynomolgus (HEK293, His)
CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.
Background
The CD200 protein plays a pivotal role in immune modulation, functioning as a costimulatory molecule that promotes T-cell proliferation. Additionally, CD200 is implicated in the potential regulation of myeloid cell activity across various tissues, as suggested by similarity-based inferences. The interaction between CD200 and its receptor, CD200R1, is facilitated through their respective N-terminal Ig-like domains. This interaction likely contributes to the regulatory processes involved in immune responses and myeloid cell function. The engagement of CD200 with CD200R1 underscores its significance in mediating immune cell communication and homeostasis, emphasizing its potential as a key player in immunomodulation.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5TQS2 (Q56-G257)
-
Gene ID/
-
Molecular Construction
-
N-term
-
CD200 (Q56-G257)
Accession # A0A2K5TQS2 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD200; CD200 Antigen; Prev. MOX1; MRC; Prev. MOX2; Antigen Identified By Monoclonal Antibody MRC OX-2; OX-2 Membrane Glycoprotein; CD200 Antigen, Isoform CRA_b; CD200 Molecule; OX-2
-
AA Sequence
QVQVVTQDEREQLYTPASLRCSLQNAQEVLIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNTTITFWNITLEDEGCYMCLFNTFGSGKISGTACLTVYVQPIVSLHYKYSEDHLNITCSATARPAPMIFWKVPRSGFENSTVTQSHPNGTTSVTSILHVKDPKNQVGKEVICQVLHLGTVTDFKQTFDKG
-
Predicted Molecular Mass
23.7 kDa
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
