Copy Link Print Information

CD200 Protein, Rhesus Macaque (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD200 Protein, Rhesus Macaque (HEK293, His)
  • Experimental Validation Results for CD200 Protein, Rhesus Macaque (HEK293, His)
  • CD200 Protein, Rhesus Macaque (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD200 protein functions as a costimulator of T-cell proliferation and is implicated in the potential regulation of myeloid cell activity across various tissues. Through their N-terminal Ig-like domains, CD200 interacts with CD200R1, establishing a molecular interaction that likely contributes to the modulation of immune responses and cellular activities. CD200 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD200 protein, expressed by HEK293 , with C-His labeled tag.

Background

The CD200 protein plays a pivotal role in immune modulation, functioning as a costimulatory molecule that promotes T-cell proliferation. Additionally, CD200 is implicated in the potential regulation of myeloid cell activity across various tissues, as suggested by similarity-based inferences. The interaction between CD200 and its receptor, CD200R1, is facilitated through their respective N-terminal Ig-like domains. This interaction likely contributes to the regulatory processes involved in immune responses and myeloid cell function. The engagement of CD200 with CD200R1 underscores its significance in mediating immune cell communication and homeostasis, emphasizing its potential as a key player in immunomodulation.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Human CD200 R1 is immobilized at 2 µg/mL (100 µL/well) can bind Rhesus Macaque CD200. The ED50 for this effect is 0.8551ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human CD200 R1 is immobilized at 2 µg/mL (100 µL/well) can bind Rhesus Macaque CD200. The ED50 for this effect is 0.8551 ng/mL.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-His
  • Accession

    H9EXH3 (Q31-G232)

  • Gene ID
    708110  [NCBI]
  • Molecular Construction
    • N-term
    • CD200 (Q31-G232)
      Accession # H9EXH3
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD200; CD200 Antigen; Prev. MOX1; MRC; Prev. MOX2; Antigen Identified By Monoclonal Antibody MRC OX-2; OX-2 Membrane Glycoprotein; CD200 Antigen, Isoform CRA_b; CD200 Molecule; OX-2

  • AA Sequence

    QVQVVTQDEREQLYTPASLRCSLQNAQEVLIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNTTITFWNITLEDEGCYMCLFNTFGSGKISGTACLTVYVQPIVSLHYKYSEDHLNITCSATARPAPMIFWKVPRSGFENSTVTLSHPNGTTSVTSILHVKDPKNQVGKEVICQVLHLGTVTDFKQTFDKG

  • Molecular Weight

    Approximately 40-49 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human CD200 R1 is immobilized at 2 µg/mL (100 µL/well) can bind Rhesus Macaque CD200. The ED50 for this effect is 0.8551 ng/mL.

  • CD200 Protein, Rhesus Macaque (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD200 Protein, Rhesus Macaque (HEK293, His)
  • Experimental Validation Results for CD200 Protein, Rhesus Macaque (HEK293, His)
  • CD200 Protein, Rhesus Macaque (HEK293, His) Product Image