CD22 Protein, Rhesus Macaque (HEK293, His)
Based on 1 Customer Validation
The Siglec-2/CD22 protein mediates B cell interactions and may direct B cell localization within lymphoid tissues.It recognizes sialylated glycoproteins, especially α-2,6-linked sialic acid, and participates in cis-interactions at the cell surface.CD22 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD22 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The Siglec-2/CD22 protein mediates B cell interactions and may direct B cell localization within lymphoid tissues.It recognizes sialylated glycoproteins, especially α-2,6-linked sialic acid, and participates in cis-interactions at the cell surface.CD22 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD22 protein, expressed by HEK293 , with C-His labeled tag.
Background
Siglec-2/CD22 Protein serves as a crucial mediator in B-cell interactions, potentially playing a role in the localization of B-cells within lymphoid tissues. Known for its ability to bind sialylated glycoproteins, including CD45, it exhibits a preference for alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. During the immune response, ligand-induced tyrosine phosphorylation suggests its involvement in the regulation of B-cell antigen receptor signaling. The protein's multifaceted role encompasses positive regulation through interaction with Src family tyrosine kinases, while concurrently acting as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains to block signal transduction through dephosphorylation of signaling molecules. Siglec-2/CD22 predominately exists as a monomer of isoform CD22-beta and can also form a heterodimer with a shorter isoform. Its intricate interactions with key molecules such as PTPN6/SHP-1, LYN, SYK, PIK3R1/PIK3R2, PLCG1, GRB2, INPP5D, and SHC1, especially upon phosphorylation, highlight its pivotal role in orchestrating complex signaling networks within B-cells. Further research is essential to unravel the precise molecular pathways and functional consequences of Siglec-2/CD22 in B-cell regulation and immune responses.
Verified Bioactivity
Determined by its ability to inhibit the proliferation of Raji cells. The ED50 for this effect is 9.78 μg/mL, corresponding to a specific activity is 1.02×102 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-His
-
Accession
EHH29920 (S20-R686)
-
Gene ID/
-
Molecular Construction
-
N-term
-
CD22 (M1-R686)
Accession # EHH29920 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
B-cell receptor CD22; BL-CAM; CD22; T-cell surface antigen Leu-14
-
AA Sequence
SKWNIEHPGTIYAWEGACVWVPCTYRVLDGALETFILFHNPEYNQNMSKFEGTRLYESTKDGKVPSGQKRVQFLGNKINNNCTLSIHPVHVNDSGQLGLRMVSKTEKWMERIHLNVSERPFPPRIQLPPKLQESQEVTLTCLLNFSCYGYQIQLQWLLEGVPMRQAAVTSTSLSTKSVFTRSELKFSPQWSHHGKIVTCELHDVDGKVLSEDMVQLNVKHTPKLTIEVTPNETIVRKGDSVTMTCKVNSSNPEYTTVSWLKDGIPLKEQNTLMLTLHEVTKSQSGRYCCRVSNDVGPATSEKVFLQVQYAPEPSRVQISQSPAVEGSEVNFLCISPANPLPTNYTWYHNGKEVQGRTEKQFQIQKILPWHAGTYSCEAENILGIGERGPGTELDVQYPPKKVTMVIENPTPIREGDTVTLSCNYSSSNPIVNHYEWRPRGAWEEPSLGVLKIQNIGWNNTAVACAACNNWCSWASPVTLNVLYAPRGVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGSLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSQGNQVMEGKTATLICESDANPPVYSYAWFDWNNQSLPYSGRMLRLEPVKVQHSGAYWCQGTNRVGKGHSPLITLTVYYSPQTIGRR
-
Molecular Weight
Approximately 100-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (240 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)