DNAM-1 Protein, Human (HEK293, hFc, Myc)
DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Human (HEK293, hFc, Myc) is the recombinant human-derived DNAM-1 protein, expressed by HEK293 , with C-Myc, C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Human (HEK293, hFc, Myc) is the recombinant human-derived DNAM-1 protein, expressed by HEK293 , with C-Myc, C-hFc labeled tag.
Background
The DNAM-1 protein is intricately involved in intercellular adhesion, lymphocyte signaling, cytotoxicity, and lymphokine secretion mediated by cytotoxic T-lymphocytes (CTL) and natural killer (NK) cells. Serving as a cell surface receptor for NECTIN2, DNAM-1, upon ligand binding, stimulates T-cell proliferation and the production of cytokines such as IL2, IL5, IL10, IL13, and IFNG. Furthermore, DNAM-1 competes with PVRIG for NECTIN2-binding, underscoring its regulatory role in cellular interactions and signaling pathways. This protein also interacts with PVR and NECTIN2, contributing to its multifaceted functions in immune responses and cellular communication.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Myc;C-hFc
-
Accession
Q15762 (E19-N247)
-
Molecular Construction
-
N-term
-
DNAM-1 (E19-N247)
Accession # Q15762 -
hFc-Myc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD226; PTA1; CD226 Molecule; T Lineage-Specific Activation Antigen 1 Antigen; CD226 Antigen; Platelet And T Cell Activation Antigen 1; DNAM-1; DNAX Accessory Molecule-1; DNAM1; DNAX Accessory Molecule 1; TLiSA1; Adhesion Glycoprotein
-
AA Sequence
EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
-
Predicted Molecular Mass
56.1 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
