CD302/CLEC13A Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CD302/CLEC13A Protein, a potential multifunctional C-type lectin receptor, may engage in endocytosis, phagocytosis, cell adhesion, and migration processes. CD302/CLEC13A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD302/CLEC13A Protein, a potential multifunctional C-type lectin receptor, may engage in endocytosis, phagocytosis, cell adhesion, and migration processes. CD302/CLEC13A Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD302/CLEC13A protein, expressed by HEK293 , with C-His labeled tag.
Background
CD302/CLEC13A protein is identified as a potential multifunctional C-type lectin receptor with putative involvement in diverse cellular processes. This protein is suggested to play roles in endocytosis and phagocytosis, highlighting its potential contribution to intracellular trafficking mechanisms. Additionally, CD302/CLEC13A is implicated in cell adhesion and migration, indicating its likely participation in cellular interactions and mobility. The multifaceted nature of CD302/CLEC13A suggests its versatility in various cellular functions, emphasizing its potential significance in immune responses and other biological processes.
Verified Bioactivity
Immobilized CD302 at 5 μg/mL (100 μL/well) can bind Mouse DEC-205/CD205 Protein (HY-P77992). The ED50 for this effect is 9.410 μg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9DCG2-2 (D21-H156)
-
Molecular Construction
-
N-term
-
CD302 (D21-H156)
Accession # Q9DCG2-2 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD302; Type I Transmembrane C-Type Lectin Receptor DCL-1; CD302 Molecule; C-Type Lectin Domain Family 13, Member A; CLEC13A; DEC205-Associated C-Type Lectin 1; CD302 Antigen; DCL1; KIAA0022; C-Type Lectin Domain Family 13 Member A; BIMLEC; C-Type Lectin B
-
AA Sequence
DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHGADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAANNH
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
