CD39L1/ENTPD2 Protein, Human (Active, CHO, His)

CD39L1/ENTPD2 protein, expressed in the nervous system, efficiently hydrolyzes ATP and various nucleotides, while showing limited hydrolysis of ADP. Its substrate specificity hierarchy highlights its regulatory role in purinergic signaling and selective nucleotide hydrolysis, contributing to precise control of neurotransmission. CD39L1/ENTPD2 Protein, Human (Active, CHO, His) is the recombinant human-derived CD39L1/ENTPD2 protein, expressed by CHO, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD39L1/ENTPD2 protein, expressed in the nervous system, efficiently hydrolyzes ATP and various nucleotides, while showing limited hydrolysis of ADP. Its substrate specificity hierarchy highlights its regulatory role in purinergic signaling and selective nucleotide hydrolysis, contributing to precise control of neurotransmission. CD39L1/ENTPD2 Protein, Human (Active, CHO, His) is the recombinant human-derived CD39L1/ENTPD2 protein, expressed by CHO, with C-His labeled tag.

Background

CD39L1/ENTPD2 protein, predominantly expressed in the nervous system, plays a pivotal role in the regulation of purinergic neurotransmission by efficiently hydrolyzing ATP and various nucleotides. Notably, CD39L1/ENTPD2 exhibits only marginal hydrolysis of ADP, indicating a substrate specificity that distinguishes it from broader nucleotide hydrolysis. The order of enzymatic activity with different substrates reveals a preference hierarchy, with ATP being hydrolyzed most effectively, followed by GTP, CTP, ITP, and UTP, whereas ADP and UDP show considerably lower hydrolytic efficiency. This nuanced substrate specificity underscores the intricate regulatory role of CD39L1/ENTPD2 in modulating purinergic signaling pathways within the nervous system, emphasizing its contribution to the finely tuned control of neurotransmission through selective nucleotide hydrolysis.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ENTPD2 (T29-D460)
      Accession # Q9Y5L3
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ENTPD2; Ecto-ATPDase 2; Prev. CD39L1; E-NTPDase 2; NTPDase-2; NTPDase 2; Ecto-ATP Diphosphohydrolase 2; CD39-Like-1; CD39 Antigen-Like 1; Ecto-ATPase; Ectonucleoside Triphosphate Diphosphohydrolase 2; Ecto-ATPase 2

  • AA Sequence

    TRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTD

  • Predicted Molecular Mass

    49 kDa

  • Molecular Weight

    Approximately 36-37 kDa & 57-63 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00