1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. CD39L1/ENTPD2 Protein, Human (Active, CHO, His)

CD39L1/ENTPD2 Protein, Human (Active, CHO, His)

Cat. No.: HY-P704471
Handling Instructions Technical Support

CD39L1/ENTPD2 protein, expressed in the nervous system, efficiently hydrolyzes ATP and various nucleotides, while showing limited hydrolysis of ADP. Its substrate specificity hierarchy highlights its regulatory role in purinergic signaling and selective nucleotide hydrolysis, contributing to precise control of neurotransmission. CD39L1/ENTPD2 Protein, Human (Active, CHO, His) is the recombinant human-derived CD39L1/ENTPD2 protein, expressed by CHO, with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CD39L1/ENTPD2 protein, expressed in the nervous system, efficiently hydrolyzes ATP and various nucleotides, while showing limited hydrolysis of ADP. Its substrate specificity hierarchy highlights its regulatory role in purinergic signaling and selective nucleotide hydrolysis, contributing to precise control of neurotransmission. CD39L1/ENTPD2 Protein, Human (Active, CHO, His) is the recombinant human-derived CD39L1/ENTPD2 protein, expressed by CHO, with C-His labeled tag.

Background

CD39L1/ENTPD2 protein, predominantly expressed in the nervous system, plays a pivotal role in the regulation of purinergic neurotransmission by efficiently hydrolyzing ATP and various nucleotides. Notably, CD39L1/ENTPD2 exhibits only marginal hydrolysis of ADP, indicating a substrate specificity that distinguishes it from broader nucleotide hydrolysis. The order of enzymatic activity with different substrates reveals a preference hierarchy, with ATP being hydrolyzed most effectively, followed by GTP, CTP, ITP, and UTP, whereas ADP and UDP show considerably lower hydrolytic efficiency. This nuanced substrate specificity underscores the intricate regulatory role of CD39L1/ENTPD2 in modulating purinergic signaling pathways within the nervous system, emphasizing its contribution to the finely tuned control of neurotransmission through selective nucleotide hydrolysis.

Species

Human

Source

CHO

Tag

C-His

Accession

Q9Y5L3 (T29-D460)

Gene ID

954

Molecular Construction
N-term
ENTPD2 (T29-D460)
Accession # Q9Y5L3
His
C-term
Protein Length

Extracellular Domain

Synonyms
Ectonucleoside triphosphate diphosphohydrolase 2; Entpd2; Cd39l1
AA Sequence

TRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTD

Predicted Molecular Mass
49.0 kDa
분자량

Approximately 36-37 kDa & 57-63 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH7.5 with glycerol as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류

CD39L1/ENTPD2 Protein, Human (Active, CHO, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD39L1/ENTPD2 Protein, Human (Active, CHO, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD39L1/ENTPD2 Protein, Human (Active, CHO, His)
Cat. No.:
HY-P704471
수량:
MCE Japan Authorized Agent: