1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily CD40 GITR/CD357
  5. CD40 Protein, Canine (HEK293, His)

CD40 Protein, the receptor for TNFSF5/CD40LG, transduces signals via TRAF6 and MAP3K8, activating ERK in macrophages and B cells, leading to immunoglobulin secretion. Existing as a monomer and homodimer, CD40 interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6), with its interaction with TRAF6 and MAP3K8 crucial for ERK activation. CD40 Protein, Canine (HEK293, His) is the recombinant canine-derived CD40 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD40 Protein, the receptor for TNFSF5/CD40LG, transduces signals via TRAF6 and MAP3K8, activating ERK in macrophages and B cells, leading to immunoglobulin secretion. Existing as a monomer and homodimer, CD40 interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6), with its interaction with TRAF6 and MAP3K8 crucial for ERK activation. CD40 Protein, Canine (HEK293, His) is the recombinant canine-derived CD40 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD40 Protein acts as the receptor for TNFSF5/CD40LG, transducing signals mediated by TRAF6 and MAP3K8 to activate ERK in macrophages and B cells, ultimately inducing immunoglobulin secretion. Existing as both a monomer and homodimer, CD40 Protein interacts with various TRAF proteins, including TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6. Furthermore, its interaction with TRAF6 and MAP3K8 is essential for the activation of ERK.

Biological Activity

Immobilized Canine CD40, His Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Human CD40 Ligand (Trimer) , hFc Tag with the EC50 of 6.5 ng/mL determined by ELISA.

Species

Canine

Source

HEK293

Tag

C-His

Accession

Q7YRL5 (E21-A194)

Gene ID
Molecular Construction
N-term
CD40 (E21-A194)
Accession # Q7YRL5
His
C-term
Protein Length

Extracellular Domain

Synonyms
Tumor Necrosis Factor Receptor Superfamily member 5; Bp50; CD40L Receptor; CDw40; TNFRSF5
AA Sequence

EPRTACREKQYLVDSQCCNMCPPGEKLVNDCLHTIDTECTRCQTGEFLDTWNAERHCHQHKYCDPNLGLHVEKEGTSETDTTCTCDEGLHCTNAACESCTMHSLCPPGLGVKQIATGISDTICDPCPIGFFSNVSSALEKCHPWTSCETKGLVKVQAGTNKTDVICGPQPRLRA

Molecular Weight

30-40 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD40 Protein, Canine (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD40 Protein, Canine (HEK293, His)
Cat. No.:
HY-P75411
Quantity:
MCE Japan Authorized Agent: