Copy Link Print Information

CD40 Protein, Canine (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD40 Protein, the receptor for TNFSF5/CD40LG, transduces signals via TRAF6 and MAP3K8, activating ERK in macrophages and B cells, leading to immunoglobulin secretion. Existing as a monomer and homodimer, CD40 interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6), with its interaction with TRAF6 and MAP3K8 crucial for ERK activation. CD40 Protein, Canine (HEK293, His) is the recombinant canine-derived CD40 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • CD40 Protein, Canine (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD40 Protein, the receptor for TNFSF5/CD40LG, transduces signals via TRAF6 and MAP3K8, activating ERK in macrophages and B cells, leading to immunoglobulin secretion. Existing as a monomer and homodimer, CD40 interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6), with its interaction with TRAF6 and MAP3K8 crucial for ERK activation. CD40 Protein, Canine (HEK293, His) is the recombinant canine-derived CD40 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD40 Protein acts as the receptor for TNFSF5/CD40LG, transducing signals mediated by TRAF6 and MAP3K8 to activate ERK in macrophages and B cells, ultimately inducing immunoglobulin secretion. Existing as both a monomer and homodimer, CD40 Protein interacts with various TRAF proteins, including TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6. Furthermore, its interaction with TRAF6 and MAP3K8 is essential for the activation of ERK.

Verified Bioactivity

Immobilized Canine CD40, His Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Human CD40 Ligand (Trimer) , hFc Tag with the EC50 of 6.5 ng/mL determined by ELISA.

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-His
  • Accession

    Q7YRL5 (E21-A194)

  • Gene ID
    403469  [NCBI]
  • Molecular Construction
    • N-term
    • CD40 (E21-A194)
      Accession # Q7YRL5
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily

  • AA Sequence

    EPRTACREKQYLVDSQCCNMCPPGEKLVNDCLHTIDTECTRCQTGEFLDTWNAERHCHQHKYCDPNLGLHVEKEGTSETDTTCTCDEGLHCTNAACESCTMHSLCPPGLGVKQIATGISDTICDPCPIGFFSNVSSALEKCHPWTSCETKGLVKVQAGTNKTDVICGPQPRLRA

  • Predicted Molecular Mass

    20.5 kDa

  • Molecular Weight

    Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CD40 Protein, Canine (HEK293, His) Product Image
    1/16
  • CD40 Protein, Canine (HEK293, His) Product Image