Copy Link Print Information

CD40 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue(s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD40 Protein, Cynomolgus (HEK293, His)
  • CD40 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue(s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD40, a crucial member of the TNFR superfamily, is characterized by the absence of conserved residue(s) necessary for the propagation of feature annotation. This distinctive feature suggests unique structural attributes in CD40, potentially influencing its functional interactions within the TNFR superfamily. The lack of these conserved residues underscores the specific nature of CD40 and emphasizes the importance of further exploration to unravel its distinct roles and regulatory mechanisms in cellular signaling pathways.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus CD40/TNFRSF5 is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Human CD40 Ligand/TNFSF5. The ED50 for this effect is 60.12 ng/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus CD40/TNFRSF5 is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Human CD40 Ligand/TNFSF5. The ED50 for this effect is 60.12 ng/mL.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession

    G7PG38 (E21-R193)

  • Gene ID
    102118696  [NCBI]
  • Molecular Construction
    • N-term
    • CD40 (E21-R193)
      Accession # G7PG38
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily

  • AA Sequence

    EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDTWNRETRCHQHKYCDPNLGLQVQQKGTSETDTICTCEEGLHCTSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQR

  • Predicted Molecular Mass

    20.2 kDa

  • Molecular Weight

    Approximately 26-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus CD40/TNFRSF5 is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Human CD40 Ligand/TNFSF5. The ED50 for this effect is 60.12 ng/mL.

  • CD40 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD40 Protein, Cynomolgus (HEK293, His)
  • CD40 Protein, Cynomolgus (HEK293, His) Product Image