CD40 Protein, Cynomolgus (HEK293, His)

CD40 Protein, a vital TNFR superfamily member, lacks conserved residue(s) crucial for feature annotation propagation, indicating unique structural attributes. This distinctiveness may influence CD40's functional interactions within the TNFR superfamily, underscoring the need for further exploration to unravel its specific roles and regulatory mechanisms in cellular signaling pathways. CD40 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD40 protein, expressed by HEK293 , with C-6*His labeled tag.

CD40, a crucial member of the TNFR superfamily, is characterized by the absence of conserved residue(s) necessary for the propagation of feature annotation. This distinctive feature suggests unique structural attributes in CD40, potentially influencing its functional interactions within the TNFR superfamily. The lack of these conserved residues underscores the specific nature of CD40 and emphasizes the importance of further exploration to unravel its distinct roles and regulatory mechanisms in cellular signaling pathways.

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus CD40/TNFRSF5 is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Human CD40 Ligand/TNFSF5. The ED₅₀ for this effect is 60.12 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus CD40/TNFRSF5 is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Human CD40 Ligand/TNFSF5. The ED₅₀ for this effect is 60.12 ng/mL.

Cynomolgus

HEK293

C-6*His

G7PG38 (E21-R193)

102118696  [NCBI]

Partial

EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDTWNRETRCHQHKYCDPNLGLQVQQKGTSETDTICTCEEGLHCTSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQR

28-30 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.