CD40 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CD40, also known as TNFR5, is a protein that exhibits defects in conserved residues necessary for feature annotation propagation. Specific residues missing in CD40 prevent the propagation of certain functional features associated with this protein. CD40 Protein, Rat (HEK293, His) is the recombinant rat-derived CD40 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD40, also known as TNFR5, is a protein that exhibits defects in conserved residues necessary for feature annotation propagation. Specific residues missing in CD40 prevent the propagation of certain functional features associated with this protein. CD40 Protein, Rat (HEK293, His) is the recombinant rat-derived CD40 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD40, also referred to as TNFR5, is a protein that exhibits deficiency in conserved residue(s) essential for feature annotation propagation. The specific residue(s) missing in CD40 prevent the propagation of certain functional characteristics associated with this protein. CD40 is a member of the tumor necrosis factor receptor (TNFR) superfamily and plays a crucial role in immune regulation and activation of various immune cells.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
A6JXD6/NP_599187.1 (L20-R193)
-
Molecular Construction
-
N-term
-
CD40 (L20-R193)
Accession # A6JXD6/NP_599187.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily
-
AA Sequence
LGQCVTCSDKQYLQGGECCDLCQPGNRLVSHCTALEKTQCQPCDSGEFSAHWNREIRCHQHRHCELNQGLQVKKEGTAVSDTVCTCKEGQHCASKECETCAQHTPCGPGFGVVQMATETTDTVCQPCPVGFFSNGSSLFEKCHPWTSCEDQKLMVLREGTSQTDTLCGFQPRMR
-
Predicted Molecular Mass
20.6 kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)