CD40 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD40, also known as TNFR5, is a protein that exhibits defects in conserved residues necessary for feature annotation propagation. Specific residues missing in CD40 prevent the propagation of certain functional features associated with this protein. CD40 Protein, Rat (HEK293, His) is the recombinant rat-derived CD40 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD40, also known as TNFR5, is a protein that exhibits defects in conserved residues necessary for feature annotation propagation. Specific residues missing in CD40 prevent the propagation of certain functional features associated with this protein. CD40 Protein, Rat (HEK293, His) is the recombinant rat-derived CD40 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD40, also referred to as TNFR5, is a protein that exhibits deficiency in conserved residue(s) essential for feature annotation propagation. The specific residue(s) missing in CD40 prevent the propagation of certain functional characteristics associated with this protein. CD40 is a member of the tumor necrosis factor receptor (TNFR) superfamily and plays a crucial role in immune regulation and activation of various immune cells.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Rat CD40/TNFRSF5 is immobilized at 5 µg/mL (100 µL/well) can bind Recombinant Human CD40 Ligand/TNFSF5. The ED50 for this effect is 668.1 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD40 (L20-R193)
      Accession # A6JXD6/NP_599187.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily

  • AA Sequence

    LGQCVTCSDKQYLQGGECCDLCQPGNRLVSHCTALEKTQCQPCDSGEFSAHWNREIRCHQHRHCELNQGLQVKKEGTAVSDTVCTCKEGQHCASKECETCAQHTPCGPGFGVVQMATETTDTVCQPCPVGFFSNGSSLFEKCHPWTSCEDQKLMVLREGTSQTDTLCGFQPRMR

  • Predicted Molecular Mass

    20.6 kDa

  • Molecular Weight

    Approximately 28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00