1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily CD40 GITR/CD357
  5. CD40 Protein, Rat (HEK293, His)

CD40, also known as TNFR5, is a protein that exhibits defects in conserved residues necessary for feature annotation propagation. Specific residues missing in CD40 prevent the propagation of certain functional features associated with this protein. CD40 Protein, Rat (HEK293, His) is the recombinant rat-derived CD40 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD40, also known as TNFR5, is a protein that exhibits defects in conserved residues necessary for feature annotation propagation. Specific residues missing in CD40 prevent the propagation of certain functional features associated with this protein. CD40 Protein, Rat (HEK293, His) is the recombinant rat-derived CD40 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD40, also referred to as TNFR5, is a protein that exhibits deficiency in conserved residue(s) essential for feature annotation propagation. The specific residue(s) missing in CD40 prevent the propagation of certain functional characteristics associated with this protein. CD40 is a member of the tumor necrosis factor receptor (TNFR) superfamily and plays a crucial role in immune regulation and activation of various immune cells.

Biological Activity
  • Measured by its binding ability in a functional ELISA. When Recombinant Rat CD40/TNFRSF5 is immobilized at 5 µg/mL (100 µL/well) can bind Recombinant Human CD40 Ligand/TNFSF5. The ED50 for this effect is 668.1 ng/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

A6JXD6/NP_599187.1 (L20-R193)

Gene ID
Molecular Construction
N-term
CD40 (L20-R193)
Accession # A6JXD6/NP_599187.1
His
C-term
Protein Length

Partial

Synonyms
Tumor Necrosis Factor Receptor Superfamily member 5; Bp50; CD40L Receptor; CDw40; TNFRSF5
AA Sequence

LGQCVTCSDKQYLQGGECCDLCQPGNRLVSHCTALEKTQCQPCDSGEFSAHWNREIRCHQHRHCELNQGLQVKKEGTAVSDTVCTCKEGQHCASKECETCAQHTPCGPGFGVVQMATETTDTVCQPCPVGFFSNGSSLFEKCHPWTSCEDQKLMVLREGTSQTDTLCGFQPRMR

Molecular Weight

Approximately 28 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD40 Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD40 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74295
Quantity:
MCE Japan Authorized Agent: