1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands CD40 Ligand/CD154
  5. CD40L/CD154/TRAP Protein, Rabbit (HEK293, His, Flag)

CD40L/CD154/TRAP Protein, Rabbit (HEK293, His, Flag)

Cat. No.: HY-P704475
Handling Instructions Technical Support

CD40L/CD154/TRAP Protein, a cytokine, acts as a CD40/TNFRSF5 ligand, stimulating T-cell proliferation and cytokine production. It also facilitates immunoglobulin class switching and binds to integrins ITGA5:ITGB1 and ITGAV:ITGB3. CD40-CD40LG signaling requires both integrins and the CD40 receptor, leading to cell-type dependent effects like B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling. CD40L/CD154/TRAP Protein, Rabbit (HEK293, His, Flag) is the recombinant rabbit-derived CD40L/CD154/TRAP protein, expressed by HEK293, with N-His and N-Flag labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
100 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CD40L/CD154/TRAP Protein, a cytokine, acts as a CD40/TNFRSF5 ligand, stimulating T-cell proliferation and cytokine production. It also facilitates immunoglobulin class switching and binds to integrins ITGA5:ITGB1 and ITGAV:ITGB3. CD40-CD40LG signaling requires both integrins and the CD40 receptor, leading to cell-type dependent effects like B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling. CD40L/CD154/TRAP Protein, Rabbit (HEK293, His, Flag) is the recombinant rabbit-derived CD40L/CD154/TRAP protein, expressed by HEK293, with N-His and N-Flag labeled tag.

Background

CD40L/CD154/TRAP Protein is a cytokine that functions as a ligand to CD40/TNFRSF5. It plays a crucial role in costimulating T-cell proliferation and cytokine production. Additionally, it is involved in immunoglobulin class switching. CD40L/CD154/TRAP Protein acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3. Activation of CD40-CD40LG signaling requires both integrins and the CD40 receptor, and this signaling pathway has cell-type dependent effects, including B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling.

Species

Rabbit

Source

HEK293

Tag

N-His;N-Flag

Accession

G1SKP7 (G116-L261)

Gene ID

100358388

Molecular Construction
N-term
CD40L (G116-L261)
Accession # G1SKP7
C-term
Protein Length

Full Length of CD40 ligand, soluble form

Synonyms
rHuCD40L; CD154; TRAP; TNFSF5; CD40LG; CD40-L
AA Sequence

GDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL

Predicted Molecular Mass
49.9 kDa
분자량

Approximately 50-55 kDa,based on SDS-PAGE under non-reduced conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD40L/CD154/TRAP Protein, Rabbit (HEK293, His, Flag)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD40L/CD154/TRAP Protein, Rabbit (HEK293, His, Flag)
Cat. No.:
HY-P704475
수량:
MCE Japan Authorized Agent: