CD40L/CD154/TRAP Protein, Rabbit (HEK293, His, Flag)
CD40L/CD154/TRAP Protein, a cytokine, acts as a CD40/TNFRSF5 ligand, stimulating T-cell proliferation and cytokine production. It also facilitates immunoglobulin class switching and binds to integrins ITGA5:ITGB1 and ITGAV:ITGB3. CD40-CD40LG signaling requires both integrins and the CD40 receptor, leading to cell-type dependent effects like B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling. CD40L/CD154/TRAP Protein, Rabbit (HEK293, His, Flag) is the recombinant rabbit-derived CD40L/CD154/TRAP protein, expressed by HEK293, with N-His and N-Flag labeled tag.
- Species: Rabbit
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD40L/CD154/TRAP Protein, a cytokine, acts as a CD40/TNFRSF5 ligand, stimulating T-cell proliferation and cytokine production. It also facilitates immunoglobulin class switching and binds to integrins ITGA5:ITGB1 and ITGAV:ITGB3. CD40-CD40LG signaling requires both integrins and the CD40 receptor, leading to cell-type dependent effects like B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling. CD40L/CD154/TRAP Protein, Rabbit (HEK293, His, Flag) is the recombinant rabbit-derived CD40L/CD154/TRAP protein, expressed by HEK293, with N-His and N-Flag labeled tag.
Background
CD40L/CD154/TRAP Protein is a cytokine that functions as a ligand to CD40/TNFRSF5. It plays a crucial role in costimulating T-cell proliferation and cytokine production. Additionally, it is involved in immunoglobulin class switching. CD40L/CD154/TRAP Protein acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3. Activation of CD40-CD40LG signaling requires both integrins and the CD40 receptor, and this signaling pathway has cell-type dependent effects, including B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling.
Technical Parameters
-
Species Rabbit
-
Source HEK293
-
Tag N-His;N-Flag
-
Accession
G1SKP7 (G116-L261)
-
Gene ID100358388
-
Molecular Construction
-
N-term
-
CD40L (G116-L261)
Accession # G1SKP7 -
C-term
-
-
Protein Length
Full Length of CD40 ligand, soluble form
-
Synonyms
CD40LG; T-BAM; Prev. TNFSF5; Tumor Necrosis Factor (Ligand) Superfamily Member 5; Prev. HIGM1; Tumor Necrosis Factor Ligand Superfamily Member 5; Prev. IMD3; T-B Cell-Activating Molecule; CD40-L; CD40 Antigen Ligand; CD40L; T-Cell Antigen Gp39; TRAP; Tumo
-
AA Sequence
GDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL
-
Predicted Molecular Mass
49.9 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under non reducing (N) conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
