CD40L/CD154/TRAP Trimer Protein, Mouse (HEK293, His-Flag)
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His;N-Flag
-
Accession
P27548 (G115-L260)
-
Gene ID21947
-
Molecular Construction
-
N-term
-
His-Flag
-
CD40L (G115-L260)
Accession # P27548 -
C-term
-
-
Protein Length
Full Length of CD40 ligand, soluble form
-
Synonyms
CD40-L; T-cell antigen Gp39; TNF-related activation protein; TRAP; TRAP; Tumor necrosis factor ligand superfa; CD40 ligand; CD154; Cd40lg; Cd40l; Tnfsf5
-
AA Sequence
GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
-
Predicted Molecular Mass
50.5 kDa
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under non reducing (N) conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
