CD5 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CD5 protein, a pivotal T-cell receptor, regulates T-cell proliferation through interactions with CD72/LYB-2. Its potential interaction with PTPN6/SHP-1 underscores its involvement in critical signaling pathways. CD5 Protein, Rat (HEK293, His) is the recombinant rat-derived CD5 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD5 protein, a pivotal T-cell receptor, regulates T-cell proliferation through interactions with CD72/LYB-2. Its potential interaction with PTPN6/SHP-1 underscores its involvement in critical signaling pathways. CD5 Protein, Rat (HEK293, His) is the recombinant rat-derived CD5 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD5 protein plays a crucial role as a receptor in the regulation of T-cell proliferation. It interacts with CD72/LYB-2 and also has a potential interaction with PTPN6/SHP-1, highlighting its involvement in important signaling pathways.
Verified Bioactivity
Immobilized Rat CD5 Protein at 1 μg/mL (100 μL/well) can bind Anti-CD5 Antibody, the ED50 for this effect is 18.65 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
P51882 (Q24-P368)
-
Molecular Construction
-
N-term
-
CD5 (Q24-P368)
Accession # P51882 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD5; Lymphocyte Antigen T1/Leu-1; Prev. LEU1; Epididymis Secretory Sperm Binding Protein; T-Cell Surface Glycoprotein CD5; CD5 Antigen; T1; CD5 Molecule; CD5 Antigen (P56-62)
-
AA Sequence
QSGRGFVGAQVMLSGSNSKCQGLVEVQMNGMKTVCSSSWRLSQDLWKNANEASTVCQQLGCGNPLALGHLTLWNRPKNQILCQGPPWSFSNCSTSSLGQCLPLSLVCLEPQKTTPLPTTTLPTTMPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSRGGTILYKAKARPVDLGNLICKSLQCGSFLTHLSRIETAGTPAPAELRDPRPLPIRWEAQNGSCTSLQQCFQKTTVQEGSQALAVVCSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWAALCDSSAARGPGRWEELCQEQQCGNLISFHVMDADRTSPGVLCTQEKLSQCYQLQKKTHCKRVFITCKDPNP
-
Molecular Weight
Approximately 46-49 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)