1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins B Cell CD Proteins Dendritic Cell CD Proteins Cell Adhesion-related CD Proteins
  4. CD5
  5. CD5 Protein, Rat (HEK293, His)

CD5 protein, a pivotal T-cell receptor, regulates T-cell proliferation through interactions with CD72/LYB-2. Its potential interaction with PTPN6/SHP-1 underscores its involvement in critical signaling pathways. CD5 Protein, Rat (HEK293, His) is the recombinant rat-derived CD5 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD5 protein, a pivotal T-cell receptor, regulates T-cell proliferation through interactions with CD72/LYB-2. Its potential interaction with PTPN6/SHP-1 underscores its involvement in critical signaling pathways. CD5 Protein, Rat (HEK293, His) is the recombinant rat-derived CD5 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD5 protein plays a crucial role as a receptor in the regulation of T-cell proliferation. It interacts with CD72/LYB-2 and also has a potential interaction with PTPN6/SHP-1, highlighting its involvement in important signaling pathways.

Biological Activity

Immobilized Rat CD5 Protein at 1 μg/mL (100 μL/well) can bind Anti-CD5 Antibody, the ED50 for this effect is 18.65 ng/mL.

  • Immobilized Rat CD5 Protein at 1 μg/mL (100 μL/well) can bind Anti-CD5 Antibody, the ED50 for this effect is 18.65 ng/mL.
Species

Rat

Source

HEK293

Tag

C-His

Accession

P51882 (Q24-P368)

Gene ID
Molecular Construction
N-term
CD5 (Q24-P368)
Accession # P51882
His
C-term
Protein Length

Partial

Synonyms
T-cell surface glycoprotein CD5; Ly-1; Lyt-1; CD5; Leu-1
AA Sequence

QSGRGFVGAQVMLSGSNSKCQGLVEVQMNGMKTVCSSSWRLSQDLWKNANEASTVCQQLGCGNPLALGHLTLWNRPKNQILCQGPPWSFSNCSTSSLGQCLPLSLVCLEPQKTTPLPTTTLPTTMPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSRGGTILYKAKARPVDLGNLICKSLQCGSFLTHLSRIETAGTPAPAELRDPRPLPIRWEAQNGSCTSLQQCFQKTTVQEGSQALAVVCSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWAALCDSSAARGPGRWEELCQEQQCGNLISFHVMDADRTSPGVLCTQEKLSQCYQLQKKTHCKRVFITCKDPNP

Molecular Weight

Approximately 46-49 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD5 Protein, Rat (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD5 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74283
Quantity:
MCE Japan Authorized Agent: