CD5 Protein, Rhesus Macaque (HEK293, His-Avi)
Based on 1 Customer Validation
CD5 Protein lacks conserved residue(s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His-Avi) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD5 Protein lacks conserved residue(s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His-Avi) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The CD5 protein is distinguished by its deficiency in conserved residue(s) crucial for the propagation of feature annotation.
Verified Bioactivity
Immobilized Rhesus macaque CD5 at 1 μg/mL (100 μL/Well) on the plate. Dose response curve for Anti-CD5 Antibody with the EC50 of ≤ 8.71 ng/mL determined by ELISA.
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
F6V5Q9 (R25-P375)
-
Gene ID/
-
Molecular Construction
-
N-term
-
CD5 (R25-P375)
Accession # F6V5Q9 -
8*His-Avi
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD5; Lymphocyte Antigen T1/Leu-1; Prev. LEU1; Epididymis Secretory Sperm Binding Protein; T-Cell Surface Glycoprotein CD5; CD5 Antigen; T1; CD5 Molecule; CD5 Antigen (P56-62)
-
AA Sequence
RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP
-
Predicted Molecular Mass
41.7 kDa
-
Molecular Weight
Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
