CD53 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
CD53 protein is an important member of the tetraspanin family and plays an important role in immune response, cell adhesion and signal transduction. Its research enhances understanding of cell membrane organization and function, with potential applications in immunology and cancer research. CD53 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD53 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD53 protein is an important member of the tetraspanin family and plays an important role in immune response, cell adhesion and signal transduction. Its research enhances understanding of cell membrane organization and function, with potential applications in immunology and cancer research. CD53 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD53 protein, expressed by HEK293 , with N-His labeled tag.
Background
The CD53 Protein is an integral member of the tetraspanin (TM4SF) family, underscoring its essential role in cellular processes, including immune responses, cell adhesion, and signal transduction. As part of this family, CD53 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in the formation of tetraspanin-enriched microdomains and interactions with other cellular molecules. The classification within the tetraspanin family underscores its specific designation within the broader context of membrane proteins, providing insights into its unique contributions to cell membrane organization and function. The study of CD53 contributes to our understanding of its role in diverse physiological processes, offering potential applications in immunology, cancer research, and a deeper comprehension of its broader impact on cellular functions. Further exploration of CD53's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.
Verified Bioactivity
Measured by its ability to inhibit chemoattract of Jurkat cell in presence of 40 ng/mL human CXCL12. At a concentration of 0.001 µg/mL, CD53 Protein, Cynomolgus(HEK 293, N-6His) effectively inhibits the chemotaxis of Jurkat cells.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-6*His
-
Accession
G7NW46 (E107-N181)
-
Molecular Construction
-
N-term
-
His
-
CD53 (E107-N181)
Accession # G7NW46 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CD53; Tspan-25; Prev. MOX44; Antigen MOX44 Identified By Monoclonal Antibody MRC-OX44; TSPAN25; Transmembrane Glycoprotein; CD53 Antigen; CD53 Tetraspan Antigen; Leukocyte Surface Antigen CD53; Cell Surface Antigen; Cell Surface Glycoprotein CD53; CD53 Gl
-
AA Sequence
EQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDPNVEGCYAKARLWFHSN
-
Molecular Weight
Approximately 19-22 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
