CD59 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage. Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage. CD59 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage. Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage. CD59 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD59 Protein emerges as a potent inhibitor of the complement membrane attack complex (MAC) action, exerting its regulatory influence at or after the C5b-8 stage of MAC assembly. This key role positions CD59 as a crucial modulator in the complement system, preventing excessive activation and the subsequent membrane damage associated with uncontrolled MAC formation. By targeting specific stages of the MAC assembly process, CD59 plays a pivotal role in maintaining the delicate balance of complement activation, highlighting its significance in the immune response and safeguarding cellular integrity from complement-mediated damage.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human C9 is present at 5 μg/mL, can bind Recombinant Cynomolgus CD59. The ED50 for this effect is 1‑3 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-6*His
-
Accession
G7PQF7 (L26-E101)
-
Molecular Construction
-
N-term
-
CD59 (L26-E101)
Accession # G7PQF7 -
His
-
C-term
-
-
Protein Length
Full Length of UPAR/Ly6 Domain
-
Synonyms
CD59; CD59 Molecule, Complement Regulatory Protein; Prev. HRF20; CD59 Blood Group Antigen; Prev. MACIF; MAC-Inhibitory Protein; Prev. MIC11; MEM43 Antigen; Prev. MSK21; 1F5 Antigen; Prev. MIN1; HRF-20; Prev. MIN2; MAC-IP; Prev. MIN3; Surface Anitgen Recog
-
AA Sequence
LQCYNCPNPTTDCKTAINCSSGFDTCLIARAGLQVYNQCWKFANCNYNDISTLLKESELRYFCCKKDLCNFNEQLE
-
Predicted Molecular Mass
9.6 kDa
-
Molecular Weight
Approximately 18 kDa & 14 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)