1. Recombinant Proteins
  2. CD Antigens Complement System
  3. NK Cell CD Proteins Stem Cell CD Proteins Erythrocyte CD Proteins Complement Regulatory Proteins
  4. CD59
  5. CD59 Protein, Cynomolgus (HEK293, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage. Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage. CD59 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage. Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage. CD59 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD59 Protein emerges as a potent inhibitor of the complement membrane attack complex (MAC) action, exerting its regulatory influence at or after the C5b-8 stage of MAC assembly. This key role positions CD59 as a crucial modulator in the complement system, preventing excessive activation and the subsequent membrane damage associated with uncontrolled MAC formation. By targeting specific stages of the MAC assembly process, CD59 plays a pivotal role in maintaining the delicate balance of complement activation, highlighting its significance in the immune response and safeguarding cellular integrity from complement-mediated damage.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human C9 is present at 5 μg/mL, can bind Recombinant Cynomolgus CD59. The ED50 for this effect is 1‑3 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human C9 is present at 5 μg/mL, can bind Recombinant Cynomolgus CD59. The ED50 for this effect is 1.031 μg/mL.
Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

G7PQF7 (L26-E101)

Gene ID
Molecular Construction
N-term
CD59 (L26-E101)
Accession # G7PQF7
His
C-term
Protein Length

Partial

Synonyms
CD59 glycoprotein; HRF-20; MAC-IP; MACIF; MIRL; CD59; MIC11; MIN1; MSK21
AA Sequence

LQCYNCPNPTTDCKTAINCSSGFDTCLIARAGLQVYNQCWKFANCNYNDISTLLKESELRYFCCKKDLCNFNEQLE

Predicted Molecular Mass
9.6 kDa
Molecular Weight

Approximately 9&16-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD59 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD59 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76242
Quantity:
MCE Japan Authorized Agent: