CD68 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CD68 is a protein belonging to the LAMP (lysosome-associated membrane protein) family. It is expressed primarily in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 Protein, Rat (HEK293, His) is the recombinant rat-derived CD68 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD68 is a protein belonging to the LAMP (lysosome-associated membrane protein) family. It is expressed primarily in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 Protein, Rat (HEK293, His) is the recombinant rat-derived CD68 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD68 is a protein that belongs to the LAMP (lysosome-associated membrane protein) family. It is primarily expressed in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 is localized to the lysosomes, which are cellular organelles responsible for the degradation of various molecules. As a lysosomal protein, CD68 plays a crucial role in the processing and presentation of antigens by macrophages and dendritic cells. It is involved in phagocytosis, the process by which these immune cells engulf and digest foreign particles, such as bacteria and cellular debris. CD68 is also implicated in inflammation and tissue remodeling, as its expression can be upregulated in response to inflammatory stimuli. Furthermore, CD68 has been identified as a potential biomarker in certain diseases, including cancer, where its expression is associated with tumor progression and poor prognosis. Understanding the functions and implications of CD68 could provide valuable insights into immune responses and disease pathogenesis.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Rat S100A8 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Rat CD68 Protein. The ED50 for this effect is 9.492 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
Q4FZY1 (K20-S295)
-
Molecular Construction
-
N-term
-
CD68 (K20-S295)
Accession # Q4FZY1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD68; LAMP4; CD68 Molecule; Scavenger Receptor Class D, Member 1; Macrosialin; Macrophage Antigen CD68; CD68 Antigen; DKFZp686M18236; SCARD1; Gp110; GP110
-
AA Sequence
KDCPHKKAATLLPSFTETPTTTGSTASPTTTHRPTTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHGNATVSPTTNSPGFSTVGPHPGPPPPSPSPSPSSTGALGNYTWTNGSQPCVQLQAQIQIRILYLTQGGKKAWGLSVLNPNKTKVQGGCDSAHPHLALSFPYGQLTFGFKQDRHQSHSTVYLNYMAVEYNVSFPQAAQWTFSAQNSSLQELQAPLGQSFCCGNTSIVLSPAIHLDLLSLRLQAAQLPDKGHFGPCFSCASDQS
-
Predicted Molecular Mass
29.5 kDa
-
Molecular Weight
Approximately 60-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)