CD68 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD68 is a protein belonging to the LAMP (lysosome-associated membrane protein) family. It is expressed primarily in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 Protein, Rat (HEK293, His) is the recombinant rat-derived CD68 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD68 is a protein belonging to the LAMP (lysosome-associated membrane protein) family. It is expressed primarily in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 Protein, Rat (HEK293, His) is the recombinant rat-derived CD68 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD68 is a protein that belongs to the LAMP (lysosome-associated membrane protein) family. It is primarily expressed in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 is localized to the lysosomes, which are cellular organelles responsible for the degradation of various molecules. As a lysosomal protein, CD68 plays a crucial role in the processing and presentation of antigens by macrophages and dendritic cells. It is involved in phagocytosis, the process by which these immune cells engulf and digest foreign particles, such as bacteria and cellular debris. CD68 is also implicated in inflammation and tissue remodeling, as its expression can be upregulated in response to inflammatory stimuli. Furthermore, CD68 has been identified as a potential biomarker in certain diseases, including cancer, where its expression is associated with tumor progression and poor prognosis. Understanding the functions and implications of CD68 could provide valuable insights into immune responses and disease pathogenesis.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Rat S100A8 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Rat CD68 Protein. The ED50 for this effect is 9.492 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Rat S100A8 is immobilized at 10 µg/mL (100 µL/well) can bind Recombinant Rat CD68 Protein. The ED50 for this effect is 9.492 μg/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD68 (K20-S295)
      Accession # Q4FZY1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD68; LAMP4; CD68 Molecule; Scavenger Receptor Class D, Member 1; Macrosialin; Macrophage Antigen CD68; CD68 Antigen; DKFZp686M18236; SCARD1; Gp110; GP110

  • AA Sequence

    KDCPHKKAATLLPSFTETPTTTGSTASPTTTHRPTTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHGNATVSPTTNSPGFSTVGPHPGPPPPSPSPSPSSTGALGNYTWTNGSQPCVQLQAQIQIRILYLTQGGKKAWGLSVLNPNKTKVQGGCDSAHPHLALSFPYGQLTFGFKQDRHQSHSTVYLNYMAVEYNVSFPQAAQWTFSAQNSSLQELQAPLGQSFCCGNTSIVLSPAIHLDLLSLRLQAAQLPDKGHFGPCFSCASDQS

  • Predicted Molecular Mass

    29.5 kDa

  • Molecular Weight

    Approximately 60-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00