CD70 Protein, Human (HEK293, His-Flag)

As a ligand of CD27, CD70 protein is an indispensable part of T cell immune coordination and is of particular importance in antiviral responses. The CD70-CD27 pathway emerged as a key player that contributes to the generation and maintenance of T cell-mediated immune responses. CD70 Protein, Human (HEK293, His-Flag) is the recombinant human-derived CD70 protein, expressed by HEK293, with N-His and N-Flag labeled tag.

CD70, a cytokine functioning as the ligand for CD27, is integral to the CD70-CD27 pathway, which holds a crucial role in the development and sustenance of T cell immunity, especially in antiviral responses. Upon binding to CD27, CD70 induces the proliferation of costimulated T-cells and amplifies the generation of cytolytic T-cells, contributing to an effective immune response. Structurally, CD70 forms homotrimers, reflecting its molecular organization. The CD70-CD27 interaction underscores its significance in orchestrating T cell-mediated immune responses, providing valuable insights into the regulation of immune functions.

Human

HEK293

N-His;N-Flag

P32970-1 (S52-P193)

970

Partial

SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Approximately 50-60 kDa,based on SDS-PAGE under non-reduced conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.