CD72 Protein, Human (Biotinylated, HEK293, His-Avi)
CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD72 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD72 Protein, Human (Biotinylated, HEK293, His-Avi) is 243 a.a., with molecular weight of 34-38 kDa.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD72 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD72 Protein, Human (Biotinylated, HEK293, His-Avi) is 243 a.a., with molecular weight of 34-38 kDa.
Background
CD72 emerges as a key participant in the orchestration of B-cell proliferation and differentiation. Operating as a homodimer with disulfide linkages, it forms associations with CD5, thereby contributing to intricate signaling networks within the B-cell context. Additionally, CD72 engages in interactions, particularly tyrosine phosphorylation, with the protein tyrosine phosphatase PTPN6/SHP-1, indicating its involvement in modulating cellular responses through intricate phosphorylation-based regulatory mechanisms. This highlights the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P21854 (R117-D359)
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CD72; LYB2; CD72 Molecule; B-Cell Differentiation Antigen CD72; CD72 Antigen; Lyb-2; CD72b
-
AA Sequence
RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
-
Predicted Molecular Mass
31.7 kDa
-
Molecular Weight
Approximately 34-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
