CD72 Protein, Human (Biotinylated, HEK293, His-Avi)

CD72 Protein plays a key role in orchestrating B-cell proliferation and differentiation, forming homodimers with disulfide linkages and interacting with CD5. It engages in tyrosine phosphorylation interactions with PTPN6/SHP-1, indicating its modulation of cellular responses through phosphorylation-based regulatory mechanisms. This underscores the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling. CD72 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD72 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD72 Protein, Human (Biotinylated, HEK293, His-Avi) is 243 a.a., with molecular weight of 34-38 kDa.

CD72 emerges as a key participant in the orchestration of B-cell proliferation and differentiation. Operating as a homodimer with disulfide linkages, it forms associations with CD5, thereby contributing to intricate signaling networks within the B-cell context. Additionally, CD72 engages in interactions, particularly tyrosine phosphorylation, with the protein tyrosine phosphatase PTPN6/SHP-1, indicating its involvement in modulating cellular responses through intricate phosphorylation-based regulatory mechanisms. This highlights the multifaceted role of CD72 in the dynamic landscape of B-cell function and signaling.

Human

HEK293

C-Avi;C-His

P21854 (R117-D359)

971  [NCBI]

Extracellular Domain

Biotin

RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD

34-38 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4 .

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.