CD82 Protein, Human (HEK293, His)
CD82, a vital immune response participant, engages with CD4 or CD8 to provide crucial costimulatory signals in the TCR/CD3 pathway. Its direct interaction with IGSF8 plays a pivotal role in modulating immune functions and mediating cellular responses. CD82 Protein, Human (HEK293, His) is the recombinant human-derived CD82 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD82, a vital immune response participant, engages with CD4 or CD8 to provide crucial costimulatory signals in the TCR/CD3 pathway. Its direct interaction with IGSF8 plays a pivotal role in modulating immune functions and mediating cellular responses. CD82 Protein, Human (HEK293, His) is the recombinant human-derived CD82 protein, expressed by HEK293 , with C-His labeled tag.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P27701-1 (G111-L228)
-
Molecular Construction
-
N-term
-
CD82 (G111-L228)
Accession # P27701-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD82; Tetraspanin-27; Prev. KAI1; Tspan-27; Prev. ST6; SAR2; TSPAN27; Suppressor Of Tumorigenicity 6 Protein; IA4; Suppression Of Tumorigenicity 6; CD82 Antigen; R2 Leukocyte Antigen; R2; GR15; Kangai 1 (Suppression Of Tumorigenicity 6, Prostate; CD82 Ant
-
AA Sequence
GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENL
-
Predicted Molecular Mass
15 kDa
-
Molecular Weight
Approximately 25-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
