CD94 Protein, Human (HEK293, mFc)
CD94 protein is a key immune receptor for self-non-self discrimination. It forms a complex with KLRC1 or KLRC2 on lymphocyte subsets and recognizes HLA-E loaded with self-peptides. It allows cytotoxic cells to monitor MHC class I expression and promote self-tolerance. CD94, Human (HEK293, mFc) is the recombinant human-derived CD94 protein, expressed by HEK293, with N-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
CD94 protein is a key immune receptor for self-non-self discrimination. It forms a complex with KLRC1 or KLRC2 on lymphocyte subsets and recognizes HLA-E loaded with self-peptides. It allows cytotoxic cells to monitor MHC class I expression and promote self-tolerance. CD94, Human (HEK293, mFc) is the recombinant human-derived CD94 protein, expressed by HEK293, with N-6*His labeled tag.
CD94 Protein, an immune receptor crucial for self-nonself discrimination, forms a complex with KLRC1 or KLRC2 on cytotoxic and regulatory lymphocyte subsets, recognizing the non-classical major histocompatibility (MHC) class Ib molecule HLA-E loaded with self-peptides derived from the signal sequence of classical MHC class Ia and other non-classical MHC class Ib molecules. This interaction enables cytotoxic cells to monitor MHC class I expression in healthy cells, fostering self-tolerance. Primarily serving as a ligand-binding subunit without the capacity to signal, the KLRD1-KLRC1 complex acts as an immune inhibitory receptor, with CD94 playing a key inhibitory role on natural killer (NK) cells. CD94 dominantly counteracts T cell receptor signaling on a subset of memory/effector CD8-positive T cells to prevent autoimmunity. On intraepithelial CD8-positive gamma-delta regulatory T cells, CD94 triggers TGFB1 secretion, limiting the cytotoxic programming of intraepithelial CD8-positive alpha-beta T cells and distinguishing harmless from pathogenic antigens. In the HLA-E-rich tumor microenvironment, CD94 acts as an immune inhibitory checkpoint, potentially contributing to the progressive loss of effector functions in NK cells and tumor-specific T cells, a state known as cell exhaustion. Upon HLA-E-peptide binding, CD94 transmits intracellular signals through KLRC1 immunoreceptor tyrosine-based inhibition motifs (ITIMs), recruiting INPP5D/SHIP-1 and INPPL1/SHIP-2 tyrosine phosphatases to ITIMs, ultimately opposing signals from activating receptors by dephosphorylating proximal signaling molecules.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q13241-1 (K32-I179)
-
Gene ID3824
-
Molecular Construction
-
N-term
-
CD94 (K32-I176)
Accession # Q13241-1 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KLRD1; Killer Cell Lectin-Like Receptor Subfamily D Member 1; Prev. CD94; KP43; Natural Killer Cells Antigen CD94; Killer Cell Lectin-Like Receptor Subfamily D Transcript B2; NK Cell Receptor; Killer Cell Lectin-Like Receptor Subfamily D Transcript 3; Kil
-
AA Sequence
KNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQ
-
Predicted Molecular Mass
44 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<0.1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)