CDC42 Protein, Human (Active, GST-His)
CDC42 is a plasma membrane-associated small GTPase that regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It participates in epithelial cell polarization, regulates the attachment of spindle microtubules to kinetochores, affects cell migration, and plays a key role in the formation of filopodia. CDC42 Protein, Human (Active, GST-His) is the recombinant human-derived CDC42 protein, expressed by E. coli, with N-His and N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CDC42 is a plasma membrane-associated small GTPase that regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It participates in epithelial cell polarization, regulates the attachment of spindle microtubules to kinetochores, affects cell migration, and plays a key role in the formation of filopodia. CDC42 Protein, Human (Active, GST-His) is the recombinant human-derived CDC42 protein, expressed by E. coli, with N-His and N-GST labeled tag.
Background
CDC42, a plasma membrane-associated small GTPase, dynamically transitions between an active GTP-bound state and an inactive GDP-bound state, modulating diverse cellular responses by interacting with various effector proteins. Notably, CDC42 is intricately involved in processes such as epithelial cell polarization, where it plays a critical role in regulating spindle microtubule attachment to kinetochores before chromosome congression in metaphase. Additionally, CDC42 influences cell migration and is pivotal for the extension and maintenance of filopodia, slender actin-rich projections, in neurons. In the context of neuronal plasticity, it participates in CaMKII-mediated signaling, impacting dendritic spine structural plasticity and contributing to long-term synaptic changes. Moreover, CDC42 is essential for the formation of spines in specific neuronal cell types, such as Purkinje cells and hippocampal neurons, through interactions with DOCK10 and DOCK11. In podocytes, it facilitates the formation of filopodia and podosomes upon activation by DOCK11. Furthermore, CDC42 plays a crucial role in the orchestration of F-actin cytoskeleton dynamics during phagocytosis, contributing to the formation of phagocytic cups. This multifaceted engagement underscores the versatility of CDC42 in regulating various cellular functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-GST
-
Accession
P60953-2 (M1-L191)
-
Gene ID998
-
Molecular Construction
-
N-term
-
His
-
GST
-
CDC42 (M1-L191)
Accession # P60953-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
CDC42; DJ224A6.1.1 (Cell Division Cycle 42 (GTP-Binding Protein, 25kD)); Cell Division Cycle 42; DJ224A6.1.2 (Cell Division Cycle 42 (GTP-Binding Protein, 25kD)); Cell Division Control Protein 42 Homolog; Cell Division Cycle 42 (GTP Binding Protein, 25kDa
-
AA Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
-
Predicted Molecular Mass
48 kDa
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)