CDX2 Protein, Human (His, Strep)

CDX2 Protein, Human (His, Strep) is the recombinant human-derived CDX2, expressed by E. coli , with Strep, His labeled tag.

CDX2 is a transcription factor that regulates the transcription of multiple genes expressed in the intestinal epithelium (By similarity). It binds to the promoter of the intestinal sucrase-isomaltase SI and activates SI transcription (By similarity), as well as the DNA sequence 5'-ATAAAAACTTAT-3' in the promoter region of VDR to activate VDR transcription (By similarity). Additionally, CDX2 binds to and activates transcription of LPH (By similarity), and also activates transcription of CLDN2 and intestinal mucin MUC2 (By similarity). It further binds to the 5'-AATTTTTTACAACACCT-3' DNA sequence in the promoter region of CA1 and activates CA1 transcription (By similarity). CDX2 plays a crucial role in a broad range of functions, from early differentiation to the maintenance of the intestinal epithelial lining in both the small and large intestine, and preferentially binds to methylated DNA.

Human

E. coli

Strep;His

Q99626 (R184-Q255)

1045

Partial

RTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQ

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 200 mM NaCl, 5% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.