1. Recombinant Proteins
  2. Others
  3. CEACAM6 Protein, Human (V239G, HEK293, His)

CEACAM6 Protein, Human (V239G, HEK293, His) is the recombinant human-derived CEACAM6 protein, expressed by HEK293, with C-His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEACAM6 Protein, Human (V239G, HEK293, His) is the recombinant human-derived CEACAM6 protein, expressed by HEK293, with C-His tag.

Background

CEACAM6 protein, a cell surface glycoprotein, assumes a pivotal role in cell adhesion and tumor progression. Interactions occur in a calcium- and fibronectin-independent manner, mediating both homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules like CEACAM5 and CEACAM8. Particularly, heterophilic interaction with CEACAM8 takes place in activated neutrophils, influencing neutrophil adhesion to cytokine-activated endothelial cells. In the context of tumor progression, CEACAM6 operates as an oncogene by positively regulating cell migration, adhesion to endothelial cells, and invasion. Additionally, it contributes to the metastatic cascade by inducing resistance to anoikis in pancreatic adenocarcinoma and colorectal carcinoma cells. CEACAM6 forms homodimers, engaging in homodimerization via its Ig-like V-type domain, and also forms heterodimers with CEACAM8 through their respective Ig-like V-type domains, highlighting its multifaceted role in cell adhesion and cancer-related processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 (HY-P77629) at 0.5 μg/mL (100 μL/well) on the plate can bind Biotinylated Human CEACAM6. The ED50 for this effect is 1.832 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 (HY-P77629) at 0.5 μg/mL (100 μL/well) on the plate can bind Biotinylated Human CEACAM6. The ED50 for this effect is 1.832 μg/mL.
Species

Human

Source

HEK293

Tag

C-His

Accession

P40199/NP_002474.4 (K35-G320, V239G)

Gene ID

4680

Protein Length

Full Length of Mature Protein

Synonyms
carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)
AA Sequence

KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

CEACAM6 Protein, Human (V239G, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CEACAM6 Protein, Human (V239G, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM6 Protein, Human (V239G, HEK293, His)
Cat. No.:
HY-P703885
Quantity:
MCE Japan Authorized Agent: