CEACAM6 Protein, Human (V239G, HEK293, His)
Based on 1 Customer Validation
CEACAM6 Protein, Human (V239G, HEK293, His) is the recombinant human-derived CEACAM6 protein, expressed by HEK293, with C-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CEACAM6 Protein, Human (V239G, HEK293, His) is the recombinant human-derived CEACAM6 protein, expressed by HEK293, with C-His tag.
Background
CEACAM6 protein, a cell surface glycoprotein, assumes a pivotal role in cell adhesion and tumor progression. Interactions occur in a calcium- and fibronectin-independent manner, mediating both homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules like CEACAM5 and CEACAM8. Particularly, heterophilic interaction with CEACAM8 takes place in activated neutrophils, influencing neutrophil adhesion to cytokine-activated endothelial cells. In the context of tumor progression, CEACAM6 operates as an oncogene by positively regulating cell migration, adhesion to endothelial cells, and invasion. Additionally, it contributes to the metastatic cascade by inducing resistance to anoikis in pancreatic adenocarcinoma and colorectal carcinoma cells. CEACAM6 forms homodimers, engaging in homodimerization via its Ig-like V-type domain, and also forms heterodimers with CEACAM8 through their respective Ig-like V-type domains, highlighting its multifaceted role in cell adhesion and cancer-related processes.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM8 (HY-P77629) at 0.5 μg/mL (100 μL/well) on the plate can bind Biotinylated Human CEACAM6. The ED50 for this effect is 1.832 μg/mL.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P40199/NP_002474.4 (K35-G320, V239G)
-
Gene ID4680
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CEACAM6; Cell Adhesion Molecule CEACAM6; Prev. NCA; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6; NCA-50/90; Non-Specific Crossreacting Antigen; CD66c; Cluster Of Differentiation 66c; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6
-
AA Sequence
KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
-
Predicted Molecular Mass
32.6 kDa
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
