CEACAM8/CD66b Protein, Human (Biotinylated, HEK293, His-Avi)
CEACAM8/CD66b Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CEACAM-8/CD66b protein, expressed by HEK293, with C-His & Avi tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CEACAM8/CD66b Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CEACAM-8/CD66b protein, expressed by HEK293, with C-His & Avi tag.
Background
CEACAM-8/CD66b is a cell surface glycoprotein involved in cell adhesion in a calcium-independent manner. It mediates heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Heterophilic interaction with CEACAM8 occurs in activated neutrophils. by similar
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His;Avi
-
Accession
P31997/NP_001807.2 (Q35-S319)
-
Gene ID1088
-
Protein Length
Full Length of Cell adhesion molecule CEACAM8 Chain
-
Conjugation
Biotin
-
Synonyms
CEACAM8; Carcinoembryonic Antigen CGM6; Prev. CGM6; CDNA, FLJ93041, Homo Sapiens Carcinoembryonic Antigen-Related Cell Adhesionmolecule 8 (CEACAM8), MRNA; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8; Carcinoembryonic Antigen Gene Family Memb
-
AA Sequence
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS
-
Predicted Molecular Mass
34.3 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
