CEACAM3 Protein, Human (His-SUMO)
The CEACAM3 protein is a key granulocyte receptor that effectively orchestrates the opsonin-independent phagocytosis of CEACAM-bound microorganisms such as Neisseria spp., Moraxella spp., and Haemophilus spp. This role places CEACAM3 at the forefront of pathogen clearance in the innate immune system. CEACAM3 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CEACAM3 protein is a key granulocyte receptor that effectively orchestrates the opsonin-independent phagocytosis of CEACAM-bound microorganisms such as Neisseria spp., Moraxella spp., and Haemophilus spp. This role places CEACAM3 at the forefront of pathogen clearance in the innate immune system. CEACAM3 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
CEACAM3 Protein emerges as a pivotal granulocyte receptor that orchestrates the efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, encompassing pathogens such as Neisseria, Moraxella, and Haemophilus species. This significant role positions CEACAM3 at the forefront of pathogen clearance within the innate immune system. In the course of pathogen phagocytosis, CEACAM3 takes on the responsibility of stimulating RAC1, further contributing to the cellular processes involved in pathogen engulfment. Notably, CEACAM3 engages in a calcium-dependent interaction with S100A9/calprotectin, a dynamic interaction that occurs independently of CEACAM3 phosphorylation. This intricate network of functions underscores the multifaceted role of CEACAM3 in orchestrating effective immune responses against a spectrum of microorganisms.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P40198 (K35-G155)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
CEACAM3 (K35-G155)
Accession # P40198 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CEACAM3; CD66d Antigen; Prev. CGM1; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3, Isoform CRA_c; CD66d; Carcinoembryonic Antigen Gene Family Member 1; CGM1a; Nonspecific Cross-Reacting Antigen; Carcinoembryonic Antigen-Related Cell Adhesion M
-
AA Sequence
KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
-
Predicted Molecular Mass
29.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
