CEACAM6 Protein, Human (HEK293, His-Avi)
Based on 1 publication(s) in Google Scholar
The CEACAM6 protein is a cell surface glycoprotein that promotes calcium- and fibronectin-independent cell-cell adhesion and mediates homo- and heterosexual interactions with other carcinoembryonic antigen-related cell adhesion molecules. CEACAM6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived CEACAM6 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CEACAM6 protein is a cell surface glycoprotein that promotes calcium- and fibronectin-independent cell-cell adhesion and mediates homo- and heterosexual interactions with other carcinoembryonic antigen-related cell adhesion molecules. CEACAM6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived CEACAM6 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
CEACAM6 protein, a cell surface glycoprotein, assumes a pivotal role in cell adhesion and tumor progression. Interactions occur in a calcium- and fibronectin-independent manner, mediating both homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules like CEACAM5 and CEACAM8. Particularly, heterophilic interaction with CEACAM8 takes place in activated neutrophils, influencing neutrophil adhesion to cytokine-activated endothelial cells. In the context of tumor progression, CEACAM6 operates as an oncogene by positively regulating cell migration, adhesion to endothelial cells, and invasion. Additionally, it contributes to the metastatic cascade by inducing resistance to anoikis in pancreatic adenocarcinoma and colorectal carcinoma cells. CEACAM6 forms homodimers, engaging in homodimerization via its Ig-like V-type domain, and also forms heterodimers with CEACAM8 through their respective Ig-like V-type domains, highlighting its multifaceted role in cell adhesion and cancer-related processes.
Verified Bioactivity
Human CEACAM-8, His Tag immobilized on CM5 Chip can bind Human CEACAM-6, His Tag with an affinity constant of <4.95 μM as determined in SPR assay (Biacore T200).
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P40199 (K35-G320)
-
Molecular Construction
-
N-term
-
CEACAM6 (K35-G320)
Accession # P40199 -
8*His-Avi
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CEACAM6; Cell Adhesion Molecule CEACAM6; Prev. NCA; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6; NCA-50/90; Non-Specific Crossreacting Antigen; CD66c; Cluster Of Differentiation 66c; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6
-
AA Sequence
KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
-
Molecular Weight
Approximately 55-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
