CEACAM6 Protein, Human (His-SUMO)

The CEACAM6 protein is a cell surface glycoprotein that promotes calcium- and fibronectin-independent cell-cell adhesion and mediates homo- and heterosexual interactions with other carcinoembryonic antigen-related cell adhesion molecules. CEACAM6 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM6 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

CEACAM6 protein, a cell surface glycoprotein, assumes a pivotal role in cell adhesion and tumor progression. Interactions occur in a calcium- and fibronectin-independent manner, mediating both homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules like CEACAM5 and CEACAM8. Particularly, heterophilic interaction with CEACAM8 takes place in activated neutrophils, influencing neutrophil adhesion to cytokine-activated endothelial cells. In the context of tumor progression, CEACAM6 operates as an oncogene by positively regulating cell migration, adhesion to endothelial cells, and invasion. Additionally, it contributes to the metastatic cascade by inducing resistance to anoikis in pancreatic adenocarcinoma and colorectal carcinoma cells. CEACAM6 forms homodimers, engaging in homodimerization via its Ig-like V-type domain, and also forms heterodimers with CEACAM8 through their respective Ig-like V-type domains, highlighting its multifaceted role in cell adhesion and cancer-related processes.

Human

E. coli

N-6*His;N-SUMO

P40199 (K35-G320, V239G)

4680  [NCBI]

Full Length of Mature Protein

V239G

Natural variant

KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

Approximately 47.2 kDa

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.