CEMP1 Protein, Human (P.pastoris, His)
CEMP1 protein may play a key role in the development of periodontal tissue, promoting the differentiation of periodontal ligament cells into cementoblasts and promoting cementum formation. CEMP1 exhibits affinity for hydroxyapatite, suggesting involvement in cementum biomineralization. CEMP1 Protein, Human (P.pastoris, His) is the recombinant human-derived CEMP1 protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CEMP1 protein may play a key role in the development of periodontal tissue, promoting the differentiation of periodontal ligament cells into cementoblasts and promoting cementum formation. CEMP1 exhibits affinity for hydroxyapatite, suggesting involvement in cementum biomineralization. CEMP1 Protein, Human (P.pastoris, His) is the recombinant human-derived CEMP1 protein, expressed by P. pastoris , with N-His labeled tag.
Background
The CEMP1 protein is implicated in potentially playing a crucial role in the development of the periodontium, the supportive tissue surrounding the teeth. It is suggested to promote the differentiation of multi-potent cells from the periodontal ligament into cementoblasts, contributing to the formation of the cementum, as evidenced by various studies. CEMP1 exhibits an affinity for hydroxyapatite and may play a role in promoting the biomineralization of the cementum, further underlining its potential involvement in the mineralization processes of dental tissues. Additionally, CEMP1 is associated with the promotion of cell proliferation, as supported by multiple studies. The multifaceted functions of CEMP1 in periodontal development and tissue mineralization emphasize its significance in dental biology, warranting further exploration to unravel its specific mechanisms and regulatory roles in these processes.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-His
-
Accession
Q6PRD7 (M1-G247)
-
Molecular Construction
-
N-term
-
His
-
CEMP1 (M1-G247)
Accession # Q6PRD7 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CEMP1; Cementum Protein 23; Cementum Protein 1; Cementum Protein-23; CP-23; CP23; Cementoblastoma-Derived Protein 1
-
AA Sequence
MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG
-
Predicted Molecular Mass
28 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
